KEGG   Vibrio furnissii: vfu_B00922Help
Entry
vfu_B00922        CDS       T01680                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vfu  Vibrio furnissii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    vfu_B00922
  Lipid metabolism
   00561 Glycerolipid metabolism
    vfu_B00922
   00600 Sphingolipid metabolism
    vfu_B00922
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     vfu_B00922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:956325..957986
Genome map
AA seq 553 aa AA seqDB search
MNGYDNHQWEQSSQLHIPHNNWYGEAQWISATLPELGYTKVNKFSLNRLSYENTGTWSSI
GHLPSAAFENTRDNITYHWQIEHNGSWQWEIGDFKDQLYVLISGPTENESHWWKQLSSGE
TFTTIPVAISVVEGGLRDALQEVNRYRRRIIKPCLDIQTLPVIFNDYMNCLFGDPTTEKL
KPLIDAAAEAGCEYFCIDCGWYSDGPWWNGVGEWKPSQARFPNGIQEPIQYIVEKGMIPG
LWLELEVIGIECALATMLPDECFFLKHGKRVIDHQRYQLDFRHPLVREHATQVIKRLVEE
YGVAYIKMDYNINAGVGTEYMADSVGDGLLQHNRAYLAWLKSTMEYYPQLVIENCGSGGL
RMDYAMLQHHSIQSITDQTDYKLMASIAASAASAVTPEQSAIWSYPLREGDREEVVMNMI
NAMLLRIHQSGHLSELSPERFDLVKEGIALYKTYREQIPNMTPHWPLGMPSFQSPWLAFY
LKQDGEVYLAVWRMDSEEESLCVPVDFAANTHAKLDCIYPSYDNEHHRWHEQSATANIII
KEKYSARLFKISA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggtatgacaatcatcaatgggaacaaagtagtcagttacatattccacacaac
aactggtatggcgaagcacaatggatcagcgcaacgttacctgagcttggctatacaaaa
gtaaacaaattttcactcaaccggctctcttatgagaacactgggacatggtcatcgatc
ggccatctaccaagcgcagcatttgaaaatacgcgcgacaatatcacctatcattggcaa
attgagcacaatggctcgtggcaatgggaaattggggatttcaaagatcaactttatgtc
ttgatcagtggtccaactgaaaatgaaagccattggtggaaacagttatcatcaggcgaa
acatttacgaccatccccgtcgcgatatctgttgttgaaggtggtttgcgggacgcactg
caagaagtcaatcgttaccgtagacgcatcataaaaccatgcctcgacattcagactttg
ccagtcatttttaatgactacatgaactgcttgtttggtgatccaaccactgagaaactt
aaacccttgattgatgcggcagcagaagctggctgtgaatatttctgtattgattgcggc
tggtattctgacggcccttggtggaatggtgttggggaatggaaaccatcacaagcgcgc
tttcccaatggcattcaagaaccgattcaatacattgttgaaaagggcatgattccaggg
ttatggctggaacttgaagtcatcggcattgaatgcgctctagccaccatgctgcccgat
gaatgctttttcctgaaacacggtaagcgtgtgatcgaccatcaacgttaccagctagat
tttcgtcatcctttggttcgcgagcacgcaacccaagtgatcaaacgtttagtcgaagag
tacggcgttgcgtacatcaaaatggattacaacattaacgcgggggttggtaccgagtat
atggcagatagcgtgggtgacggattattacagcacaaccgcgcctacctcgcttggttg
aagagtaccatggaatactatcctcagttggtgattgaaaactgtgggagcggcggcctg
cgaatggattacgccatgctacaacaccacagtattcaatccattaccgatcagaccgat
tacaagctcatggcatcgatcgccgccagtgcggcctcggcagtgacgccagaacaaagt
gcgatttggtcgtatccattaagagaaggcgatcgtgaagaagtcgtgatgaatatgatc
aacgccatgttgttacgcattcatcaaagtggtcatctatcagaattaagtcctgaacgg
tttgatttagtcaaagaaggcatcgcactctacaaaacataccgagaacaaatacccaac
atgacaccccattggccactcggcatgccttcatttcagtcaccttggctcgcgttttat
ttgaaacaagacggtgaagtctacttagcggtttggcgaatggatagcgaggaagaatca
ctttgtgttccggttgattttgccgccaacactcatgccaaattggactgtatttatcca
agttacgacaacgagcaccaccgttggcatgagcaatccgcgaccgcaaacatcatcatc
aaagagaaatattcagccagactctttaagatatcggcttaa

DBGET integrated database retrieval system