KEGG   Vibrio furnissii: vfu_B00922Help
Entry
vfu_B00922        CDS       T01680                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vfu  Vibrio furnissii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vfu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vfu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vfu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:956325..957986
Genome map
AA seq 553 aa AA seqDB search
MNGYDNHQWEQSSQLHIPHNNWYGEAQWISATLPELGYTKVNKFSLNRLSYENTGTWSSI
GHLPSAAFENTRDNITYHWQIEHNGSWQWEIGDFKDQLYVLISGPTENESHWWKQLSSGE
TFTTIPVAISVVEGGLRDALQEVNRYRRRIIKPCLDIQTLPVIFNDYMNCLFGDPTTEKL
KPLIDAAAEAGCEYFCIDCGWYSDGPWWNGVGEWKPSQARFPNGIQEPIQYIVEKGMIPG
LWLELEVIGIECALATMLPDECFFLKHGKRVIDHQRYQLDFRHPLVREHATQVIKRLVEE
YGVAYIKMDYNINAGVGTEYMADSVGDGLLQHNRAYLAWLKSTMEYYPQLVIENCGSGGL
RMDYAMLQHHSIQSITDQTDYKLMASIAASAASAVTPEQSAIWSYPLREGDREEVVMNMI
NAMLLRIHQSGHLSELSPERFDLVKEGIALYKTYREQIPNMTPHWPLGMPSFQSPWLAFY
LKQDGEVYLAVWRMDSEEESLCVPVDFAANTHAKLDCIYPSYDNEHHRWHEQSATANIII
KEKYSARLFKISA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggtatgacaatcatcaatgggaacaaagtagtcagttacatattccacacaac
aactggtatggcgaagcacaatggatcagcgcaacgttacctgagcttggctatacaaaa
gtaaacaaattttcactcaaccggctctcttatgagaacactgggacatggtcatcgatc
ggccatctaccaagcgcagcatttgaaaatacgcgcgacaatatcacctatcattggcaa
attgagcacaatggctcgtggcaatgggaaattggggatttcaaagatcaactttatgtc
ttgatcagtggtccaactgaaaatgaaagccattggtggaaacagttatcatcaggcgaa
acatttacgaccatccccgtcgcgatatctgttgttgaaggtggtttgcgggacgcactg
caagaagtcaatcgttaccgtagacgcatcataaaaccatgcctcgacattcagactttg
ccagtcatttttaatgactacatgaactgcttgtttggtgatccaaccactgagaaactt
aaacccttgattgatgcggcagcagaagctggctgtgaatatttctgtattgattgcggc
tggtattctgacggcccttggtggaatggtgttggggaatggaaaccatcacaagcgcgc
tttcccaatggcattcaagaaccgattcaatacattgttgaaaagggcatgattccaggg
ttatggctggaacttgaagtcatcggcattgaatgcgctctagccaccatgctgcccgat
gaatgctttttcctgaaacacggtaagcgtgtgatcgaccatcaacgttaccagctagat
tttcgtcatcctttggttcgcgagcacgcaacccaagtgatcaaacgtttagtcgaagag
tacggcgttgcgtacatcaaaatggattacaacattaacgcgggggttggtaccgagtat
atggcagatagcgtgggtgacggattattacagcacaaccgcgcctacctcgcttggttg
aagagtaccatggaatactatcctcagttggtgattgaaaactgtgggagcggcggcctg
cgaatggattacgccatgctacaacaccacagtattcaatccattaccgatcagaccgat
tacaagctcatggcatcgatcgccgccagtgcggcctcggcagtgacgccagaacaaagt
gcgatttggtcgtatccattaagagaaggcgatcgtgaagaagtcgtgatgaatatgatc
aacgccatgttgttacgcattcatcaaagtggtcatctatcagaattaagtcctgaacgg
tttgatttagtcaaagaaggcatcgcactctacaaaacataccgagaacaaatacccaac
atgacaccccattggccactcggcatgccttcatttcagtcaccttggctcgcgttttat
ttgaaacaagacggtgaagtctacttagcggtttggcgaatggatagcgaggaagaatca
ctttgtgttccggttgattttgccgccaacactcatgccaaattggactgtatttatcca
agttacgacaacgagcaccaccgttggcatgagcaatccgcgaccgcaaacatcatcatc
aaagagaaatattcagccagactctttaagatatcggcttaa

DBGET integrated database retrieval system