KEGG   Vibrio furnissii: vfu_B01008Help
Entry
vfu_B01008        CDS       T01680                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vfu  Vibrio furnissii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    vfu_B01008
Enzymes [BR:vfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     vfu_B01008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1051166..1053346
Genome map
AA seq 726 aa AA seqDB search
MKEQNALKQVAAMAKIADHYVSAWGDEARVEDDTIRRLLASLGYDITNDDTLLKSAEKKH
KKDVLDPVLVIREGEAVEVPLYLGVSARESEFNWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPSDLAWGYHTLHITRKRRKAPYEMTLIITPPACFKQPALEQSKKLWGPSVQLY
TLRTQHNWGIGDFGDLKQLVADIASRGGDFVGLNPIHSLFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSGEAQQRVGSPDFQQRLQKVREEHWVNYTEVAQMKMSVLPLLFAEFK
TRHLDKNTDRANAFLNFVEEGGESLLHQATFDALHADLHAKDSQVWGWPVFPEKYRRFDS
PAVQKYIEENQDSVHLYMYLQWIADTQINEAQALAEEKGMSVGLYRDLAVGVSDSGSETW
ADEGNLILDASIGAPPDILGPLGQNWGLPPLNPQVLQATAYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGENATKGAYIYYPVKDMLAILALESHRHQCSVIGEDLGTVPDEIVE
LLRDAGVHSYKVFFFETSKDDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKLGGE
IGLYPDAEQLAALFDDRLKCKQGILDSVAWHGFLPDGVGRDASLVPMDSYLSEALQLHVA
AGASALLSVQLEDWLEMDKPVNIPGTVNEYPNWRRKLSMNLDEIFARDDVNRIASKLTEV
RAKASR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaaatgcattaaagcaagtcgcagcgatggcaaagattgccgatcactat
gtgagcgcatggggcgatgaagcgcgcgttgaagacgacactatccgtcgtcttttggcg
tctttggggtatgacatcaccaatgatgacaccttactgaaatcggcagagaaaaagcac
aagaaagacgtgttggatcctgttctggtgattcgtgaaggtgaagcggtagaagttccg
ctctatctgggcgtgagcgcacgtgaaagcgaatttaactggcgtcttgaaaccgagcaa
ggagaggtacttgaaggctatcttcaatctcaaatcgttcgagacgagcgtgccgagggt
ggccctctagtgtttgccctgccaagtgatttggcgtggggctaccatacgttgcacatc
acacgtaaacgtcgcaaagcgccatatgaaatgacgctgatcatcacgccgccggcctgc
tttaagcaacccgctctggaacaaagcaaaaaactgtggggcccaagtgtgcagctgtac
acgctacgcactcagcataactggggtattggtgactttggcgacttgaaacaactggtt
gccgacatcgcatcgcgcggtggcgattttgtgggtcttaaccccatccattccctgttc
ccagccaatccggaaggcgcgagcccatacagcccgtcgtctcgccgttggttgaacatt
ctttacatcgatgtgagctctgtgccggaatttgcgctgagcggtgaagcgcagcaacgc
gtcggtagccctgacttccagcaacgtctgcaaaaagtgcgcgaagaacactgggtgaat
tacaccgaagtggcgcaaatgaagatgagcgtattgccactattgtttgcggagtttaag
acacgccatctcgataaaaataccgatcgcgccaacgcgttcctcaactttgttgaagag
ggcggtgagagcttgttgcatcaagcaacatttgatgcgctgcatgctgatctacatgcc
aaagacagccaagtgtggggctggccggtattccctgagaaatatcgccgttttgacagc
cctgccgtgcagaaatacattgaagagaaccaagacagcgtgcatctctacatgtaccta
caatggattgcggacacgcaaatcaatgaagcacaagcactggccgaagagaaaggcatg
tctgttggcttgtaccgtgacttagcggtgggcgtgtcggattcaggttccgaaacgtgg
gcggatgaaggcaacttgatcctcgatgccagcattggcgcgccgccagacattctgggc
ccactgggtcagaactgggggctgccaccgctgaacccgcaagtgctgcaagccacggcg
tacgatgcgtacatcaagctactgcgtgccaacatgaaacattgcggcgcgctgcgcatt
gaccacgtgctgggtctgctgcgtttatggtggattcctaagggtgaaaacgcgaccaaa
ggcgcgtacatctactacccagtgaaagatatgctggcgattttggcgctggaatctcac
cgtcatcagtgcagcgtgatcggcgaagacttgggcaccgtgccggatgaaatcgttgaa
ctgctgcgtgatgcaggcgtgcattcgtacaaagtgttcttctttgaaacgtcaaaagat
gatggcggcttcatttcgccgaagcattacgctgagcaatctatggcagcgctgtgtacg
catgacatgccgacgctgcgtggtttctggcactgcgacgacctgaaattgggcggtgaa
attggtctgtatccagacgcggagcaattggcggcgctgtttgacgatcgcctgaagtgc
aagcaaggcattttggattcagtggcatggcacggtttcttgcctgacggcgttggccgt
gatgccagcctcgtcccgatggattcctacctcagcgaagcgctgcaactgcacgttgcg
gcaggcgcttcagcattgctgagtgttcagcttgaagactggttggaaatggataaaccg
gtcaacattccgggcacggtcaatgagtacccgaactggcgccgtaagttgtctatgaat
ctggatgaaattttcgcccgtgacgacgtgaaccgcattgcgtcgaaactgacggaagtc
cgtgcgaaagcgagccgataa

DBGET integrated database retrieval system