KEGG   Vibrio furnissii: vfu_B01009Help
Entry
vfu_B01009        CDS       T01680                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vfu  Vibrio furnissii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    vfu_B01009
Enzymes [BR:vfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     vfu_B01009
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   vfu_B01009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1053643..1055700
Genome map
AA seq 685 aa AA seqDB search
MPGADGVELVIDGEPRIALAREDESGFVLKSSRDLRFTHYQLAVNWAGVEQLIDDPYQYH
SIYAEFDDLHTPKQMYHFLGSHFTTQERDGKQITGVRFLVYAPHASSCSVIGSFNQWDGR
RHPMQRLDYGIWGLFIPGLEAGAQYKFELKGPNGEGLPHKADPWGSYAEQYPSFASVVYD
HDAYQWQDAVWQTRPVTEKRKEALSFYELHAGSWKRGEDGRFLNYRELADQLVPYLVDMG
YTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGTPDDFKYFVDACHQAGLGVVLDWVPAH
FPSDDHGLANFDGTPLYHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEMFHID
GIRVDAVASMLYLDYSRSHDQWIPNVDGGRENYDAIATLKWMNEEVYKYFPNAMTIAEES
TAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIQEDPVHRKYHHNTLTFPLIYAFSENYV
LSLSHDEVVYGKRSLIYKMPGDEWQQTANMRAYLGYMYGQPGKKLNFMGAEIAQTAEWNH
DDQLQWFLLDFPRHKGVQSLVRDLNHLYRHEAALHELDCDPKGFEWRLQDSAEASVIAHE
RFSENGERILVVTNFTPVPHESFRLGVPNTGRYQLLLNSDAIQYGGSGFEVNTLVATEKV
ASEGLPQSLKLRVPPLATLMYKLID
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgctgacggcgttgagctggtgattgacggcgaaccccgaatcgcgctggcg
cgcgaagatgagtctggatttgttctcaaatcatcccgtgaccttcgttttactcattat
caactagcggtgaattgggcgggtgttgagcagctcattgatgacccgtaccaatatcat
tcgatttatgctgagtttgatgatctgcacactcctaagcagatgtatcatttcctgggg
tcgcatttcacgacacaagaacgtgatggcaaacagattaccggggttcgctttttagtt
tatgcgccgcacgcgtcatcgtgcagcgtgattggttcattcaaccaatgggatggtcgc
cgccatccgatgcaacgcctggactacggcatctggggcttgtttattcccggactcgaa
gcgggcgcgcagtacaaatttgaactcaaaggtccaaacggtgaaggcttgcctcacaaa
gcagacccttggggcagttatgccgagcaatacccatcgttcgcctccgtggtttacgat
cacgacgcatatcaatggcaggatgcggtgtggcaaactcgcccggtgactgaaaaacgc
aaagaagctctgtcgttttatgagctacacgcgggttcgtggaaacgcggcgaagatggc
cgtttcctcaactatcgtgaattggcggatcaactggtgccttatttggtcgatatgggt
tacacccatgtggagctgatgccggtgtctgagcatccgttttacggctcttggggttat
cagccagtgggtttatttgcgccaaccagtcgctacggcacgcctgatgatttcaaatac
ttcgtcgatgcctgtcaccaagcggggttgggcgtggtgcttgactgggtaccggctcat
ttcccatcggatgaccatggtttggccaacttcgatggcacgccgctctatcacgacccg
gatccacgccgaggttggcatcaggattggaactcctacatctatgacttagggcgcgag
cacgtgcgccgtttcctcgtttccaacgcgctgtactggtttgagatgttccacattgat
ggcattcgcgttgatgcagtggcatcgatgctgtacctcgattactcgcgcagccacgat
cagtggattcccaacgtcgatggtggccgtgagaactacgatgcgattgcaacgttgaag
tggatgaacgaggaggtgtacaaatacttcccgaatgcgatgaccattgccgaagaatcc
acggcgtttccgggggtctctgcgccaacctttatgggcggtttgggctttggctttaaa
tggaacatgggttggatgcacgacagcctgtcgtacattcaggaagatccagtgcaccgc
aagtatcaccacaatacgctgacgttcccgctgatttacgcctttagcgaaaactacgtt
ttgtctctatcgcacgatgaagtggtgtacggcaagcgctctctgatctacaaaatgccg
ggtgatgaatggcagcaaaccgccaacatgcgtgcttatttgggctacatgtatggtcag
ccgggcaaaaaactcaactttatgggcgcagaaatcgctcagacggcggagtggaatcac
gacgatcagctgcaatggttcttgttggactttcctcgtcacaaaggggtgcaaagtctg
gtgcgtgatttgaaccatctgtatcgccatgaagcggcattgcatgagttagattgcgat
ccgaaaggatttgaatggcgtctgcaagattctgctgaagccagcgtgattgcccatgaa
cgctttagtgaaaatggcgagcgcattctggtggtcacgaacttcacgcctgtaccgcac
gaatcgttccgccttggcgttccgaatactgggcgctatcagttgctgctcaacagcgat
gccattcagtacggtggcagcggctttgaggtcaatacgctggtggcgacggagaaggta
gccagtgaaggtctgcctcagtcactaaaactgcgtgtgccgcctttggccaccttgatg
tataagttgatcgattaa

DBGET integrated database retrieval system