KEGG   Vibrio furnissii: vfu_B01199Help
Entry
vfu_B01199        CDS       T01680                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vfu  Vibrio furnissii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    vfu_B01199
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     vfu_B01199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1262182..1263099
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRESFKLDGMNIRGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTAE
AIDPDLQHIRDANYLLMQLETPLDGIVKAAQVAKEARTNVILNPAPARELPDALLSCVDV
ITPNETEAEVLTGITVTDDASAQLAADALHLKGIEIVMITLGAKGVWLSQNGRGTLIPGF
RVQATDTTAAGDTFNGALVTGLLEEMPLESAIKFAHAAAAISVTRFGAQTSIPNREEVDA
FLADH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttggtggtattaggtagtgtcaatgctgaccatgttcttcaagtgccttct
tttcctcgccccggcgagacgctgcacggtcgcaactaccaagttatcccaggtggcaaa
ggtgccaaccaagcggtcgccgccgcgcgcttaaatgccgatatcggcttcattgcctgc
gtcggtgatgactcatttggcatcaacattcgagaaagctttaagctcgatggcatgaac
attcgtggtgtgaaaatgcagccgaactgcccaaccggcattgcgatgattcaggtctcg
gacagcggcgaaaacagcatttgcatttctgctgaagcgaacgccaaactgaccgctgaa
gcaattgaccccgatctgcaacacattcgtgacgccaactacctgttgatgcaactggaa
acgccgcttgatggcatcgtcaaagcggcgcaagtggccaaagaagcccgtaccaatgtg
attctgaaccctgcgcccgcacgtgaactgccggatgccttattaagttgtgtggatgtg
atcacgcctaatgaaaccgaagcggaagtgctgacgggcatcacggtgaccgatgacgcg
tctgcgcaattggcagcggatgcactgcaccttaaagggattgaaattgtcatgatcacg
ctgggtgcaaaaggcgtgtggctgagccagaatggccgtggcacgctgatcccgggtttc
cgcgttcaggcaacggacacaaccgccgcaggcgatacctttaatggggcgctggtcact
ggtttgttagaggaaatgcctttagaatcagcaattaagtttgctcatgcggcggcagcc
atttcggtcactcgttttggcgcccaaacttccatcccgaaccgtgaggaagtggacgcg
tttttggccgatcattaa

DBGET integrated database retrieval system