KEGG   Vibrio furnissii: vfu_B01229Help
Entry
vfu_B01229        CDS       T01680                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
vfu  Vibrio furnissii
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    vfu_B01229
   00500 Starch and sucrose metabolism
    vfu_B01229
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     vfu_B01229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1302043..1304595
Genome map
AA seq 850 aa AA seqDB search
MNRISRLAVGISSLMCGSVSAAIPLYDVVVAKDGSGDFTSVQQAIDAAPQNNQQYVIYIR
KGIYPERLNITRNNLYLIGEDRDRTIITASFANGTLDANGVRTGTAGSRTVYVNALDFKA
RTVTIENGFDFNANQAKDANDPTKLRDTQAVALMVAQKADRAQFKDVNLVGYQDTLYLRG
GRSVFEESVISGNVDFIFGHGTGLFKSTELVARNRFDVAPGTPYGYITAPSTNIEQPFGL
VFKDCRLTKEEGVPADSYGLGRPWHPTTTFADGRYADPNAIGHAAFIDCDMDDHIYGWDK
MSGRDIDQQTIWFYPQDSRFWEYESRGPGAALGEQRPQLKTAALSQYSDDKVLSGWQADL
SLGQNSELHGEVLHNLMRFPAQVTVRDSAGKQRQTQTDAKGRYQLSIAGMTGPLLVSADD
RSGSSCLHSDQPRSVCATALVVDLNNNAVSTGNVNPFSDLQVSNLATREGIDGPQHLLEL
ERLPAFSRQIWLETNQQFRQLNGGQDALNSPVSYAPTLHPQMKALADNVVHNRGYNSRTG
LANQVALTDAAFQPIINLNAVSQYLVTADQLAMQRQRVQNAETRLFIVGDSTASNYEPDV
FPRMGWGQALAEKLSDMPNLAVVNAARSGRSSRDFINGLWLSHLEPMVKAGDYLFIQFGH
NDSKCNRAASGRGEVDVLNLCTYPNDTNGQVQFPQGEEALSFQRSLERYIEFALEHNMQP
VLLTSVPRVRNDSNRPELPLTTQQHVTRQNSQHGFEFVGSYYQTVLDTARLHQVPVLDIQ
QRMIEATNQQGDWRHLWLAVDPNDYPYYQGRTGSLDKPDTTHFQQAGAQLVAELVWDEMR
AQIALFTENI
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcagtcggttagctgttgggatttcgtcgctgatgtgtggcagcgtcagt
gccgctatccctttgtatgacgtggtggtggcgaaagatggcagtggcgacttcacgtcg
gtccaacaagccattgacgcggccccgcagaataatcagcaatacgtcatctacattcgc
aaaggcatttaccccgagcgactcaatatcacgcggaacaacctctatttgatcggcgaa
gatcgggatcgcaccatcatcaccgcatcgtttgccaatggcacgctcgatgccaatggt
gtgcgaacgggcaccgcgggcagccgcacggtgtacgtcaatgccctcgattttaaagcg
cgcacggtcacgattgaaaatggctttgatttcaacgcgaaccaagccaaagacgccaac
gaccccaccaagttacgcgacacacaagccgtggcgttgatggtggcgcaaaaagcagat
cgcgcccaatttaaagatgtgaatctggtcggctatcaagacacgctctatttgcgcggg
ggacgcagcgtgtttgaagaatccgtgattagcggtaacgtcgattttatttttggccac
ggcaccgggttgtttaagtccaccgagctggtggcgcgcaaccgctttgacgttgcgccg
ggcacgccgtatggctacatcaccgcgccgtccaccaacattgagcaaccctttggcttg
gtatttaaagattgccgtttgaccaaggaagagggtgtgccagcagacagctacggttta
gggcgtccttggcaccccaccaccacgtttgccgatggccgttacgcggatccgaacgcc
attggtcatgcggcgtttattgattgcgacatggacgaccacatttacggctgggacaag
atgagcggtcgcgatattgatcaacaaaccatctggttctatccgcaagattcccgtttc
tgggaatatgaaagccgaggcccgggcgcggcgttgggtgaacaacgcccacaactgaaa
acggcggcactgagtcaatacagcgacgacaaagtgctctcgggctggcaagcggatctg
tcgctggggcaaaacagtgagttacacggcgaagtgctacacaacctgatgcgcttccct
gcacaggtaaccgtgcgtgacagcgcgggcaagcagcgccaaacacaaaccgatgccaaa
gggcgataccagctgtcgattgcggggatgacggggccgctactggtcagtgccgatgat
cgcagtgggtcatcgtgcttgcacagcgaccaaccgcgttcggtgtgtgcaacggcgttg
gtggtggatctgaacaacaatgctgtctcgaccggtaacgttaaccctttcagtgattta
caagtctccaatctggcgacgcgagaaggcatcgacggcccgcagcatctgctggaactc
gaacgcctgcccgcgttctctcgtcaaatctggcttgagaccaaccagcaatttcgacag
ttgaacggtgggcaagacgccctgaattcacctgtgtcgtatgcgcccaccctgcatcca
cagatgaaagcgctggcggataacgtcgtgcacaaccgcggctacaacagccgtacgggg
ctggcgaatcaagtggcgttaaccgacgctgcatttcagccgatcatcaacctcaatgcg
gtgtcgcagtatttggtgaccgccgatcaacttgccatgcagcgtcagcgcgttcaaaac
gccgaaacgcgcctgtttattgttggggattccaccgcctcgaattacgagccggatgtg
tttccgcgcatgggatggggccaagcgttggcggaaaaattgagtgacatgcctaatttg
gcggtggtgaatgcggcgcgctctgggcgcagctcgcgtgatttcatcaacggcctgtgg
ttaagccatcttgaaccgatggtgaaagcgggcgactacctgtttattcagtttggtcac
aacgattcgaagtgtaatcgcgctgccagcggtcgcggtgaggtcgatgtcctcaatttg
tgtacttatcccaacgataccaatggtcaggtgcagtttccgcaaggcgaagaggctttg
tcgttccaacgctctttagagcgctatattgagtttgcgctggaacacaacatgcagccg
gtactgctcacttctgtgccgcgtgtgcgtaacgacagcaatcgtcccgagttaccgctg
acgacgcagcagcatgtgacgcgccaaaacagccaacatggctttgagtttgtgggcagt
tactatcaaaccgtgcttgataccgcgcgcttgcatcaggtgcctgtgctcgatattcaa
caacgaatgattgaggcgacaaaccaacaaggcgattggcgtcacctgtggttggcggtc
gacccgaacgattacccgtattaccaagggcgtaccggcagcctcgataagcccgatacc
acgcacttccagcaagcgggcgcgcaattggtcgcggagctggtatgggatgagatgcgc
gctcaaatcgctttgttcactgagaacatctaa

DBGET integrated database retrieval system