KEGG   Vibrio furnissii: vfu_B01382Help
Entry
vfu_B01382        CDS       T01680                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vfu  Vibrio furnissii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    vfu_B01382
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     vfu_B01382
   3.1.2  Thioester hydrolases
    3.1.2.-  
     vfu_B01382
Lipid biosynthesis proteins [BR:vfu01004]
 Fatty acid synthase
  Component type
   vfu_B01382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1460634..1461131)
Genome map
AA seq 165 aa AA seqDB search
MPIEQAWPSLLSSALAGNGKNVSVVNGSISGDTTGNGLDRLPSLLKQHQPDTVLIELGAN
DGLRGFPPKVVENNLRAMIEQIQASKSHVILMQIRIPPNYGKRYSDAIAQLYPTLSDEKS
VPLIPFFLEQVIVKPEWMMNDGLHPKPEAQPWIADFMAQQLAPLL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgagcaagcttggcccagtttactcagcagtgcgttggcgggaaacggcaaa
aatgtatcggttgttaacggcagtatttccggcgataccacaggcaatggccttgaccgt
ttgccatccctgctgaaacaacatcaacccgacaccgtgttgatcgagctgggcgccaat
gacggtttacgcggctttcctcccaaagtggtcgaaaacaatttacgcgcgatgatcgaa
caaattcaggccagtaagagtcacgtgattctgatgcaaattcgcattccgcccaattac
ggcaagcgttacagcgatgcgatcgcccaactgtaccccaccctgtctgacgaaaaatcc
gtgccgctgatcccgttttttctggaacaagtcatcgttaaacccgaatggatgatgaac
gatggtttgcaccctaaaccggaagcacaaccttggatcgccgactttatggcgcaacaa
ctcgcgccattgctctga

DBGET integrated database retrieval system