KEGG   Vibrio furnissii: vfu_B01382Help
Entry
vfu_B01382        CDS       T01680                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vfu  Vibrio furnissii
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vfu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1460634..1461131)
Genome map
AA seq 165 aa AA seqDB search
MPIEQAWPSLLSSALAGNGKNVSVVNGSISGDTTGNGLDRLPSLLKQHQPDTVLIELGAN
DGLRGFPPKVVENNLRAMIEQIQASKSHVILMQIRIPPNYGKRYSDAIAQLYPTLSDEKS
VPLIPFFLEQVIVKPEWMMNDGLHPKPEAQPWIADFMAQQLAPLL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgagcaagcttggcccagtttactcagcagtgcgttggcgggaaacggcaaa
aatgtatcggttgttaacggcagtatttccggcgataccacaggcaatggccttgaccgt
ttgccatccctgctgaaacaacatcaacccgacaccgtgttgatcgagctgggcgccaat
gacggtttacgcggctttcctcccaaagtggtcgaaaacaatttacgcgcgatgatcgaa
caaattcaggccagtaagagtcacgtgattctgatgcaaattcgcattccgcccaattac
ggcaagcgttacagcgatgcgatcgcccaactgtaccccaccctgtctgacgaaaaatcc
gtgccgctgatcccgttttttctggaacaagtcatcgttaaacccgaatggatgatgaac
gatggtttgcaccctaaaccggaagcacaaccttggatcgccgactttatggcgcaacaa
ctcgcgccattgctctga

DBGET integrated database retrieval system