KEGG   Vibrio furnissii: vfu_B01463Help
Entry
vfu_B01463        CDS       T01680                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vfu  Vibrio furnissii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:vfu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vfu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vfu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vfu00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1545423..1546574)
Genome map
AA seq 383 aa AA seqDB search
MKSFMLPDLGEGLAESEIVEWHVNVGDVVKVDQVVLTVETAKATVEVPAPYAGKIISRYG
NEGDVINIGSLLLEIEELDSAGNAISSPQKKHDAATVVGNVSHQSHNVDVDDFWVGSSEQ
ANPTKKSLSALPAARLLAQRLGVDLQRLQGTGPDGLIVESDVQNAADQQIPGTEVLKGAR
RTMVNTMTESHLQVAAVTITEEALLTEWKPGEDISIRLIQAIVSACQQEPAMNAWFDAET
MTRCVHSTVNIGIAVDSAHGLYVPVLRRADTFEPQAMREWLDTTVQGIRERKIGREQLQH
ATITLSNFGAIAGIFATPVVSPPQVTIVGAGRIIEKVMIKDEQLMNVKAMPLSITFDHRA
CTGGEAARFARALVQDLQRPSAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatttatgttacccgacctcggtgaggggttagccgaatcagaaatcgtcgaa
tggcatgtcaacgtcggcgatgtggtaaaagtcgatcaagtcgtgctgacggtggaaacc
gccaaagccacggttgaagtgcccgcgccatacgcgggtaaaatcatcagtcgttacggc
aatgaaggggatgtgatcaacatcggcagtttgcttctggaaattgaagagctcgacagc
gccggcaacgccatatccagtccccagaaaaaacacgacgcagcgaccgtggtcggcaat
gtctcccaccagtcacacaatgtggatgtggatgacttctgggtgggcagcagcgagcag
gccaatccgacgaagaaatcactctccgccctacccgccgcccgcctgctggcgcagcgt
ctcggcgtggatttacagcgtttacaaggcaccggccccgatggtttgattgtcgagagt
gatgtgcagaatgccgccgaccaacagatccccggcacggaagtgctcaaaggcgcacga
agaaccatggtcaacaccatgactgaatcgcacctgcaagttgcggcggtcaccatcacc
gaagaagccctgctgaccgagtggaagccgggtgaagacatctcgattcgcctcattcag
gcgattgtttctgcctgccagcaagagccagcaatgaacgcttggtttgatgccgaaacc
atgacccgttgcgtgcacagcaccgtcaatatcggcattgcagtcgacagcgcccacggc
ttatatgtgccagtactgcgccgcgcggatacatttgaaccccaagcgatgcgtgaatgg
ctcgataccaccgtgcaagggattcgcgaacgcaaaattggccgcgaacagttacagcac
gctaccatcacgttatccaactttggcgcgattgctgggatcttcgcgacgccagtcgtg
tcaccgcctcaggtcaccattgttggtgccggtcgcatcatcgaaaaagtgatgatcaaa
gacgagcaattgatgaacgtgaaagcgatgccgctgtcgattaccttcgaccaccgtgcc
tgcacaggcggtgaagcggcccgttttgcccgcgcactggtgcaagatctgcaacgtcca
agcgcgctgtaa

DBGET integrated database retrieval system