KEGG   Vibrio furnissii: vfu_B01502Help
Entry
vfu_B01502        CDS       T01680                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vfu  Vibrio furnissii
Pathway
vfu00220  Arginine biosynthesis
vfu00330  Arginine and proline metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01130  Biosynthesis of antibiotics
vfu01230  Biosynthesis of amino acids
Module
vfu_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    vfu_B01502
   00330 Arginine and proline metabolism
    vfu_B01502
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     vfu_B01502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADT89672
UniProt: F0M0Y9
Position
2:1581630..1582514
Genome map
AA seq 294 aa AA seqDB search
MSQSNTLRLIFPQWQGGNNEPYFLGAQLLNWLAPQHDGPVETVDVALPQGQTLAVVDGVL
ARPQLIQQLEDAQAKIQRHQPERIVVLGGDCLVDLAPFAYLNEKYQGDLAILWVDAHPDI
MTPAQFSHAHAMVLGNLLGLGDAQFCSYVAKPVNARNVCYLGVNEPTTWEAQQMNALGLA
NVSPQQLQAEGSQPLVDWFRSTGAKHLAIHLDLDVLDPNLFRALLFSNVADDPALFDGVA
KGKLSMTQVIDALTDMAGVADVVGLGIAEHLPWDALALKTMMARLPLLGNNGSR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatccaatacgttgagactaatttttccacagtggcaagggggcaacaacgaa
ccctatttcttgggcgcgcagttgttaaattggttagcgccacaacatgacgggccggtt
gaaactgtcgacgtggcgttgccgcaaggccaaacgctggcagtggtggatggggtgctg
gcacggccgcaactgatccaacaactcgaagatgctcaagcaaaaatccagcgccatcaa
cccgagcgcattgttgtgctgggcggtgattgcttggtcgacttggccccatttgcctac
ctgaacgagaaatatcagggcgatttagccattttgtgggtcgatgcgcatcccgacatc
atgacgccggcgcagttcagtcatgcgcatgcgatggtactgggcaacctgcttggcctc
ggcgacgctcaattttgtagttacgtggcaaaaccggtgaacgctcgcaatgtttgctat
ttgggggtcaatgaaccgaccacttgggaagcgcaacaaatgaacgcgttgggcttagcg
aatgtttctccgcagcaactgcaagcagaggggagccagccgttggttgattggttccgt
tcaacgggcgcgaagcatcttgccattcacttggatttggatgtgcttgatccgaacttg
ttccgtgcgttgctgttctccaacgtggctgatgatccggcgttattcgatggcgtggcg
aaaggcaaactgagcatgacacaagtgattgacgcattgacagacatggcgggggtggct
gatgtggtggggttgggtattgcagaacatctgccatgggatgctttggcgctgaaaacc
atgatggcgcgcttgcctctattggggaataatggctcgcgataa

DBGET integrated database retrieval system