KEGG   Vibrio furnissii: vfu_B01502Help
Entry
vfu_B01502        CDS       T01680                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vfu  Vibrio furnissii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vfu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vfu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1581630..1582514
Genome map
AA seq 294 aa AA seqDB search
MSQSNTLRLIFPQWQGGNNEPYFLGAQLLNWLAPQHDGPVETVDVALPQGQTLAVVDGVL
ARPQLIQQLEDAQAKIQRHQPERIVVLGGDCLVDLAPFAYLNEKYQGDLAILWVDAHPDI
MTPAQFSHAHAMVLGNLLGLGDAQFCSYVAKPVNARNVCYLGVNEPTTWEAQQMNALGLA
NVSPQQLQAEGSQPLVDWFRSTGAKHLAIHLDLDVLDPNLFRALLFSNVADDPALFDGVA
KGKLSMTQVIDALTDMAGVADVVGLGIAEHLPWDALALKTMMARLPLLGNNGSR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatccaatacgttgagactaatttttccacagtggcaagggggcaacaacgaa
ccctatttcttgggcgcgcagttgttaaattggttagcgccacaacatgacgggccggtt
gaaactgtcgacgtggcgttgccgcaaggccaaacgctggcagtggtggatggggtgctg
gcacggccgcaactgatccaacaactcgaagatgctcaagcaaaaatccagcgccatcaa
cccgagcgcattgttgtgctgggcggtgattgcttggtcgacttggccccatttgcctac
ctgaacgagaaatatcagggcgatttagccattttgtgggtcgatgcgcatcccgacatc
atgacgccggcgcagttcagtcatgcgcatgcgatggtactgggcaacctgcttggcctc
ggcgacgctcaattttgtagttacgtggcaaaaccggtgaacgctcgcaatgtttgctat
ttgggggtcaatgaaccgaccacttgggaagcgcaacaaatgaacgcgttgggcttagcg
aatgtttctccgcagcaactgcaagcagaggggagccagccgttggttgattggttccgt
tcaacgggcgcgaagcatcttgccattcacttggatttggatgtgcttgatccgaacttg
ttccgtgcgttgctgttctccaacgtggctgatgatccggcgttattcgatggcgtggcg
aaaggcaaactgagcatgacacaagtgattgacgcattgacagacatggcgggggtggct
gatgtggtggggttgggtattgcagaacatctgccatgggatgctttggcgctgaaaacc
atgatggcgcgcttgcctctattggggaataatggctcgcgataa

DBGET integrated database retrieval system