KEGG   Viruses: 1261021Help
Entry
1261021           CDS       T40000                                 

Gene name
T7p25
Definition
(RefSeq) Enterobacteria phage T7; hypothetical protein
Taxonomy
TAX:10760
  Lineage
Viruses; dsDNA viruses, no RNA stage; Caudovirales; Podoviridae; Autographivirinae; T7virus; Escherichia virus T7
Taxonomy
Organism
vg  Viruses (Escherichia virus T7)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
Position
NC_001604:12988..13326
AA seq 112 aa AA seqDB search
MRKVAPFLLLTYVVLAHYANYLILLLPLSVISKAICLTLSSFVFSSAALLVILVSLATWN
TTRKPDGLNHQVTQGKKSHTQSQQTGPTTLTSDRILDDFPDDYEKFRWRVPF
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggtcgccccgtttctattactgacctacgtggttctggcgcactacgccaac
tatctgatactattattgcccttgagcgtaatcagcaaggcgatatgcctaaccttgtcc
tcgttcgtattctcaagtgccgctttactggtgatactggtatcgctggctacatggaat
acaacaaggaaaccggatggcttgaaccatcaagttactcaggggaagaagagtcacact
cagagtcaacagactggtccaacgacactgacttctgacaggattcttgatgactttcca
gacgactacgagaagtttcgctggagagtcccattctaa

DBGET integrated database retrieval system