KEGG   Viruses: 155348Help
Entry
155348            CDS       T40000                                 

Gene name
HIV1gp1
Definition
(RefSeq) Human immunodeficiency virus 1; Gag-Pol
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus group
Taxonomy
Organism
vg  Viruses (Human immunodeficiency virus 1)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
Structure
PDB: 
1NH0 4EJD 3DS4 5IVT 4MC9 5AGZ 3DS2 5AH8 3KFR 4MC6 2XT1 2O4L 3TH9 5AHA 2BB9 4U7V 3QN8 4MC1 3QIH 2XDE 2PC0 2QNP 5AH9 3WNF 3QP0 3QBF 2PWO 2PK6 5IVS 2QNN 5IVR 5AH6 5AHB 5AHC 3WNH 4NX4 2PXR 2PWR 2I4U 2I4V 2I4D 1XL2 4G1Q 3ZPT 4E43 2O4S 5AH7 3ZPS 2PQZ 2I4W 2I4X 4MC2 5IVQ 2R43 4COC 3QRS 3VQ8 3DS0 3DS1 2O4K 1EXQ 3QPJ 3QRO 4IPY 5KRT 4CF8 3KT2 3CKT 2ZGA 2NPH 1ZPK 3KDB 2WHH 5KRS 5JPA 4U7Q 4CJU 4CJQ 4CJ3 3WNE 4CIE 4CIG 4CHO 4CHY 4CGF 4OVL 4CEZ 4CEF 4CEQ 4CER 3VQE 3VQ5 4E91 3AVF 3AVG 3AVI 3AVJ 3AV9 3AVA 3NLS 2X83 3I8W 2WKZ 2BBB 2BUO 1M9X 1HYV 1B9D 1B9F 1A8O 1DIF 4QAG 4CJT 1M9E 3QRM 1XL5 1M9F 4J93 5HRN 4CK1 4CJK 3WNG 4CGG 4CEB 4CEC 4CED 4I8Z 3AVK 3BHE 2UXZ 5JL4 5HGK 4CGH 3MIM 2UY0 4U0C 4CJL 3AVC 3KFN 3KFP 2PWC 4CK3 4GB2 4EJK 1EC0 5KAO 5COK 5CON 5COO 4Q5M 4CJS 4CJR 4CJ4 4CIF 4CHZ 4CEA 4CEE 4LH4 4K4Q 4K4R 3ZPU 4INB 4ICL 4E92 2XYF 3AO5 3AO2 3NF7 3M9F 3KT5 3KFS 3KF0 3KDD 3BGC 2ZD1 2R3T 2QMP 2O4P 1SP5 1G35 1EC3 1BWB 1HWR 1HVH 1QBR 1QBS 1QBU 1HXW 1PRO 1HVC 1HVR 1HVI 1HVK 1HVL 5HRP 4B4N 2R38 1EBW 4OJR 3BC4 1IIQ 4COP 4CK2 4CF0 4CES 4KFB 3AVB 3DLK 2PYN 5HRS 4ID1 5HRR 3AVH 3AVL 3AVM 2XV6 5V4Y 5HGN 4QGI 4CJF 4CJE 4NYF 4CHP 4CFC 4CF1 4CEO 3VQ9 4E1M 3AO3 3NF6 3NF8 3MGE 2X2D 2WL0 3H47 3BGB 2PYM 2PWM 2PK5 2GON 2FLE 2A4F 1IZH 1M9Y 1G6L 1BWA 2BPV 2BPY 1MER 1MES 1MET 1MEU 1HPV 2R3W 1ZJ7 4TSX 5HGP 4CJV 4CJW 4CJ5 4CHQ 4CFB 4CF2 4LQW 4LL3 4KO0 4IG3 4ID5 4HLA 3AO4 3NTE 3NF9 3NFA 3LPU 1G2K 1BIZ 1BIS 4I8W 1D4Y 3LRY 1ZSF 5HGO 5COP 4QNB 4CJP 4CHN 4CGD 4FE6 4E1N 2XYE 3LPT 3DOX 2AZ8 2AQU 1ZBG 1RL8 1NPV 1NPW 1NPA 1MSM 1MRW 1M9C 1EC2 3TLH 1BV7 1BV9 1BL3 1ODY 1A8K 1A30 1AXA 1AJV 1AJX 7UPJ 1DMP 1ODX 1HPX 1HSG 1HTG 1HVJ 1HIV 5HVP 3DPH 1EBZ 2B4J 1ZP8 1ZPA 1B92 5HGM 4U0E 3K2P 5TEO 5DZM 4U0A 4O0J 4CFA 4IFV 1ZSR 4CGI 3PSU 4JLH 3QIP 5CYM 4CF9 4CE9 4IFY 4IDK 3AVN 3BGR 2P3B 1T7K 1LV1 1EC1 1OHR 1QBT 1ODW 4PHV 2YNG 2YKN 5CYQ 4CGJ 4CFD 4DG1 2HB4 1ZTZ 4GVM 4TVG 4LH5 4TVH 3KDC 3DLG 2QAK 2Q63 2GOL 1U8G 1LZQ 1BHL 1RTH 1VRT 1HIH 1HTF 1HEF 1HEG 4U0F 3T11 1UPJ 5VQZ 3LP1 4O55 1HVS 1EBY 5D3G 4KV8 4I2P 3MEC 3LAK 3DYA 2RKI 2QNQ 2OPS 1ZLF 1HYZ 1A9M 1HXB 1TCX 1GNM 1GNN 1GNO 1HBV 1ITG 1HPS 1SBG 1HOS 4K4P 2Z54 5KGW 5VQY 1RTJ 2YNF 1AK4 4O5B 5VQX 5K14 3T1A 3MEE 3DS5 2RF2 2ONT 1S1T 1K6Y 1VIJ 1VIK 1VRU 1HRH 5J2M 4XFX 2BE2 4DMN 1M0B 4WE1 2YNI 5VQS 5VQW 5TXL 4IG0 4I7F 3P05 3N3I 3MED 3ISN 3GGA 3DOL 3DLE 2Q64 2IAJ 2HNY 2HND 2AZ9 1JLA 1JKH 1FK9 1EP4 1C70 1D4S 1C1B 1C1C 1BI4 1BIU 1A8G 2BPZ 1HPO 1AAQ 4PQU 3TAM 3LAL 1C0U 5J2P 5VQQ 5VQR 5TXN 5TXO 3LAN 3IS9 2OPP 1RT1 1RT2 5VQT 5VQV 4NCG 5VQU 5C24 4ZHR 4WYM 3T19 3QO9 3FFI 3DRP 3DMJ 1TKT 1S9E 1S1V 1JLF 1JLG 1FB7 1BAJ 1A43 2ITG 1REV 1LWC 4RW6 5EU7 4GW6 3KLI 3DI6 2B6A 1KLM 5KGX 4RW4 3M8P 4KSE 4LSL 5TXM 5TXP 5TER 4XFZ 4I2Q 3V6D 3QLH 3M8Q 3KK1 3I0S 3H4E 3GGX 3DS3 3C6T 3C6U 2FDE 1S1W 1HQU 1HQE 1C0T 1DLO 1HHP 3PHV 5TUQ 4O4G 1EET 5HRO 3LAM 5J2Q 3LP0 4XFY 4U0B 4M0I 3V4I 3S85 3MEG 3LP2 3LP3 3ITH 3IRX 2WON 3IG1 2VG5 2QHC 2OPQ 1TV6 1TL3 1S9G 1S1X 1R0A 1MUI 1LWF 1LW0 1JLE 1IKX 1EX4 1DTQ 1RT6 2HMI 2BPW 2BPX 1HNI 1HTE 1RDH 9HVP 1TKZ 1LWE 2VG7 5C25 5TW3 4H4M 3V81 1TKX 1QE1 4RW8 4MFB 4R5P 4O44 4KKO 3DRR 5J1E 5J2N 5HP1 4PUO 2YNH 4H4O 2YKM 3KLH 3KK2 3KK3 2JLE 3DOK 2ZE2 2OPR 2B5J 1TL1 1SV5 1S6P 1FKO 1FKP 1RT4 1RT5 3HVT 5HLF 3NBP 3E01 2BAN 3I0R 4RW9 5UV5 5I3U 4U0D 4PWD 3JSM 2IC3 2HNZ 1YT9 1T05 1SUQ 1S6Q 1S1U 1N6Q 1LW2 1JLB 1JLC 1JLQ 1IKV 1IKW 1IKY 1HYS 1HPZ 1DTT 1RT7 1RT3 1AUM 1TVR 2UPJ 1RTI 1HNV 2HVP 4RW7 2VG6 5HBM 3GGV 5TEP 5HGL 5FDL 4LSN 3KJV 3DM2 1T03 1N5Y 1FQX 1BQM 3KLF 3DRS 2I5J 3KLE 2WOM 1RTD 1UWB 1HMV 5I4T 5I42 4Q0B 4B3O 3JYT 1BQN 5C42 1J5O 3KLG 1AFV 5L93 3DTJ 5HOT 1HVU 4B3P 5UPW 4B3Q 3P0A 5MCX 5MD9 5MD6 5MCZ 5MD1 5MD5 5MD0 5MD4 5MD7 5MDA 5MDB 5MDC 5MDE 5MD3 5MDD 5MDF 5MD2 5MD8 3J4F 3J34 5MDG 5MCY 4USN 5FJB 3DIK 4D1K 5T82 5IRT 5I1R 2M8N 2M8P 2M8L 2LF4 2L6E 2L4L 2KOD 2JYL 2JYG 2JPR 2JO0 2CEM 2CEN 2CEJ 2BQV 1WBK 1WBM 1U57 1O1W 1GWP 1L6N 1E6J 1QMC 1BMX 1BJ6 1WJE 1WJF 1WJA 1WJB 1WJC 1WJD 1TAM 1BVE 1BVG 1IHV 1IHW
Thumbnails

Jmol
Position
NC_001802:join(336..1637,1637..4642)
AA seq 1435 aa AA seqDB search
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQI
LGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
DTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT
PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTT
STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF
YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
RVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
HQMKDCTERQANFLREDLAFLQGKAREFSSEQTRANSPTRRELQVWGRDNNSPSEAGADR
QGTVSFNFPQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGG
FIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLK
PGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIP
SINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDL
EIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWT
VNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEP
VHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQ
KITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEP
IVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEV
NIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
AGIRKVLFLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQ
VDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTI
HTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLK
TAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNP
LWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgagagcgtcagtattaagcgggggagaattagatcgatgggaaaaaattcgg
ttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcagggag
ctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagacaaata
ctgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattatataat
acagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaaggaagct
ttagacaagatagaggaagagcaaaacaaaagtaagaaaaaagcacagcaagcagcagct
gacacaggacacagcaatcaggtcagccaaaattaccctatagtgcagaacatccagggg
caaatggtacatcaggccatatcacctagaactttaaatgcatgggtaaaagtagtagaa
gagaaggctttcagcccagaagtgatacccatgttttcagcattatcagaaggagccacc
ccacaagatttaaacaccatgctaaacacagtggggggacatcaagcagccatgcaaatg
ttaaaagagaccatcaatgaggaagctgcagaatgggatagagtgcatccagtgcatgca
gggcctattgcaccaggccagatgagagaaccaaggggaagtgacatagcaggaactact
agtacccttcaggaacaaataggatggatgacaaataatccacctatcccagtaggagaa
atttataaaagatggataatcctgggattaaataaaatagtaagaatgtatagccctacc
agcattctggacataagacaaggaccaaaggaaccctttagagactatgtagaccggttc
tataaaactctaagagccgagcaagcttcacaggaggtaaaaaattggatgacagaaacc
ttgttggtccaaaatgcgaacccagattgtaagactattttaaaagcattgggaccagcg
gctacactagaagaaatgatgacagcatgtcagggagtaggaggacccggccataaggca
agagttttggctgaagcaatgagccaagtaacaaattcagctaccataatgatgcagaga
ggcaattttaggaaccaaagaaagattgttaagtgtttcaattgtggcaaagaagggcac
acagccagaaattgcagggcccctaggaaaaagggctgttggaaatgtggaaaggaagga
caccaaatgaaagattgtactgagagacaggctaattttttaagggaagatctggccttc
ctacaagggaaggccagggaattttcttcagagcagaccagagccaacagccccaccaga
agagagcttcaggtctggggtagagacaacaactccccctcagaagcaggagccgataga
caaggaactgtatcctttaacttccctcaggtcactctttggcaacgacccctcgtcaca
ataaagataggggggcaactaaaggaagctctattagatacaggagcagatgatacagta
ttagaagaaatgagtttgccaggaagatggaaaccaaaaatgatagggggaattggaggt
tttatcaaagtaagacagtatgatcagatactcatagaaatctgtggacataaagctata
ggtacagtattagtaggacctacacctgtcaacataattggaagaaatctgttgactcag
attggttgcactttaaattttcccattagccctattgagactgtaccagtaaaattaaag
ccaggaatggatggcccaaaagttaaacaatggccattgacagaagaaaaaataaaagca
ttagtagaaatttgtacagagatggaaaaggaagggaaaatttcaaaaattgggcctgaa
aatccatacaatactccagtatttgccataaagaaaaaagacagtactaaatggagaaaa
ttagtagatttcagagaacttaataagagaactcaagacttctgggaagttcaattagga
ataccacatcccgcagggttaaaaaagaaaaaatcagtaacagtactggatgtgggtgat
gcatatttttcagttcccttagatgaagacttcaggaagtatactgcatttaccatacct
agtataaacaatgagacaccagggattagatatcagtacaatgtgcttccacagggatgg
aaaggatcaccagcaatattccaaagtagcatgacaaaaatcttagagccttttagaaaa
caaaatccagacatagttatctatcaatacatggatgatttgtatgtaggatctgactta
gaaatagggcagcatagaacaaaaatagaggagctgagacaacatctgttgaggtgggga
cttaccacaccagacaaaaaacatcagaaagaacctccattcctttggatgggttatgaa
ctccatcctgataaatggacagtacagcctatagtgctgccagaaaaagacagctggact
gtcaatgacatacagaagttagtggggaaattgaattgggcaagtcagatttacccaggg
attaaagtaaggcaattatgtaaactccttagaggaaccaaagcactaacagaagtaata
ccactaacagaagaagcagagctagaactggcagaaaacagagagattctaaaagaacca
gtacatggagtgtattatgacccatcaaaagacttaatagcagaaatacagaagcagggg
caaggccaatggacatatcaaatttatcaagagccatttaaaaatctgaaaacaggaaaa
tatgcaagaatgaggggtgcccacactaatgatgtaaaacaattaacagaggcagtgcaa
aaaataaccacagaaagcatagtaatatggggaaagactcctaaatttaaactgcccata
caaaaggaaacatgggaaacatggtggacagagtattggcaagccacctggattcctgag
tgggagtttgttaatacccctcccttagtgaaattatggtaccagttagagaaagaaccc
atagtaggagcagaaaccttctatgtagatggggcagctaacagggagactaaattagga
aaagcaggatatgttactaatagaggaagacaaaaagttgtcaccctaactgacacaaca
aatcagaagactgagttacaagcaatttatctagctttgcaggattcgggattagaagta
aacatagtaacagactcacaatatgcattaggaatcattcaagcacaaccagatcaaagt
gaatcagagttagtcaatcaaataatagagcagttaataaaaaaggaaaaggtctatctg
gcatgggtaccagcacacaaaggaattggaggaaatgaacaagtagataaattagtcagt
gctggaatcaggaaagtactatttttagatggaatagataaggcccaagatgaacatgag
aaatatcacagtaattggagagcaatggctagtgattttaacctgccacctgtagtagca
aaagaaatagtagccagctgtgataaatgtcagctaaaaggagaagccatgcatggacaa
gtagactgtagtccaggaatatggcaactagattgtacacatttagaaggaaaagttatc
ctggtagcagttcatgtagccagtggatatatagaagcagaagttattccagcagaaaca
gggcaggaaacagcatattttcttttaaaattagcaggaagatggccagtaaaaacaata
catactgacaatggcagcaatttcaccggtgctacggttagggccgcctgttggtgggcg
ggaatcaagcaggaatttggaattccctacaatccccaaagtcaaggagtagtagaatct
atgaataaagaattaaagaaaattataggacaggtaagagatcaggctgaacatcttaag
acagcagtacaaatggcagtattcatccacaattttaaaagaaaaggggggattgggggg
tacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaatta
caaaaacaaattacaaaaattcaaaattttcgggtttattacagggacagcagaaatcca
ctttggaaaggaccagcaaagctcctctggaaaggtgaaggggcagtagtaatacaagat
aatagtgacataaaagtagtgccaagaagaaaagcaaagatcattagggattatggaaaa
cagatggcaggtgatgattgtgtggcaagtagacaggatgaggattag

DBGET integrated database retrieval system