KEGG   Viruses: 2947769Help
Entry
2947769           CDS       T40000                                 

Gene name
FV3gorf69R
Definition
(RefSeq) Frog virus 3; hypothetical protein
Taxonomy
TAX:10493
  Lineage
Viruses; dsDNA viruses, no RNA stage; Iridoviridae; Alphairidovirinae; Ranavirus
Taxonomy
Organism
vg  Viruses (Frog virus 3)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
Position
NC_005946:78845..79111
AA seq 88 aa AA seqDB search
MERSATLEMLNVHKPDARQTGDILSRYANALWPPALAYAASVAAGYVFTAGPHGCRCGKA
MTEAARVGVFLGVLCALYNWMGSGDSFA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatcagctacgctagagatgctcaacgttcacaagcccgacgccaggcagacg
ggagacatactgagcaggtacgccaacgccctgtggcccccggccctggcgtacgccgcc
tccgtggccgccggctacgtctttacggcgggcccccacggctgcaggtgcggaaaggcc
atgaccgaggccgccagggtcggagtgttcctgggggttctgtgtgccctgtacaactgg
atggggtcgggagactcttttgcgtga

DBGET integrated database retrieval system