KEGG   Viruses: 912273Help
Entry
912273            CDS       T40000                                 

Gene name
NP, NDVgp1
Definition
(RefSeq) Newcastle disease virus B1; nucleocapsid protein
Taxonomy
TAX:139270
  Lineage
Viruses; ssRNA viruses; ssRNA negative-strand viruses; Mononegavirales; Paramyxoviridae; Avulavirus; Avian avulavirus 1
Taxonomy
Organism
vg  Viruses (Avian avulavirus 1)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
Position
NC_002617:122..1591
AA seq 489 aa AA seqDB search
MSSVFDEYEQLLAAQTRPNGAHGGGEKGSTLKVDVPVFTLNSDDPEDRWSFVVFCLRIAV
SEDANKPLRQGALISLLCSHSQVMRNHVALAGKQNEATLAVLEIDGFANGTPQFNNRSGV
SEERAQRFAMIAGSLPRACSNGTPFVTAGAEDDAPEDITDTLERILSIQAQVWVTVAKAM
TAYETADESETRRINKYMQQGRVQKKYILYPVCRSTIQLTIRQSLAVRIFLVSELKRGRN
TAGGTSTYYNLVGDVDSYIRNTGLTAFFLTLKYGINTKTSALALSSLSGDIQKMKQLMRL
YRMKGDNAPYMTLLGDSDQMSFAPAEYAQLYSFAMGMASVLDKGTGKYQFAKDFMSTSFW
RLGVEYAQAQGSSINEDMAAELKLTPAARRGLAAAAQRVSEVTSSIDMPTQQVGVLTGLS
EGGSQALQGGSNRSQGQPEAGDGETQFLDLMRAVANSMREAPNSAQGTPQSGPPPTPGPS
QDNDTDWGY
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgtattcgacgagtacgaacagctcctcgcggctcagactcgccccaatgga
gctcatggagggggggagaaagggagtaccttaaaagtagacgtcccggtattcactctt
aacagtgatgacccagaagataggtggagctttgtggtattctgcctccggattgctgtt
agcgaagatgccaacaaaccactcaggcaaggtgctctcatatctcttttatgctcccac
tcacaggtaatgaggaaccatgttgcccttgcagggaaacagaatgaagccacattggcc
gtgcttgagattgatggctttgccaacggcacgccccagttcaacaataggagtggagtg
tctgaagagagagcacagagatttgcgatgatagcaggatctctccctcgggcatgcagc
aacggcaccccgttcgtcacagccggggctgaagatgatgcaccagaagacatcaccgat
accctggagaggatcctctctatccaggctcaagtatgggtcacagtagcaaaagccatg
actgcgtatgagactgcagatgagtcggaaacaaggcgaatcaataagtatatgcagcaa
ggcagggtccaaaagaaatacatcctctaccccgtatgcaggagcacaatccaactcacg
atcagacagtctcttgcagtccgcatctttttggttagcgagctcaagagaggccgcaac
acggcaggtggtacctctacttattataacctagtaggggacgtagactcatatatcagg
aataccgggcttactgcattcttcttgacactcaagtacggaatcaacaccaagacatca
gcccttgcacttagtagcctctcaggcgacatccagaagatgaagcagctcatgcgtttg
tatcggatgaaaggagataatgcgccgtacatgacattacttggtgatagtgaccagatg
agctttgcgcctgccgagtatgcacaactttactcctttgccatgggtatggcatcagtc
ctagataaaggtactgggaaataccaatttgccaaggactttatgagcacatcattctgg
agacttggagtagagtacgctcaggctcagggaagtagcattaacgaggatatggctgcc
gagctaaagctaaccccggcagcaaggaggggcctggcagctgctgcccaacgagtctcc
gaggtgaccagcagcatagacatgcctactcaacaagtcggagtcctcactgggcttagc
gaggggggatcccaagccctacaaggcggatcgaatagatcgcaagggcaaccagaagcc
ggggatggggagacccaattcctggatctgatgagagcggtagcaaatagcatgagggag
gcgccaaactctgcacagggcactccccaatcggggcctcccccaactcctgggccatcc
caagataacgacaccgactgggggtattga

DBGET integrated database retrieval system