KEGG   Viruses: 935188Help
Entry
935188            CDS       T40000                                 

Gene name
HN, HPIV2gp5
Definition
(RefSeq) Human rubulavirus 2; hemagglutinin-neuraminidase
  KO
K19247  
hemagglutinin-neuraminidase [EC:3.2.1.18]
Taxonomy
TAX:1979160 [GN:T40042]
  Lineage
Viruses; ssRNA viruses; ssRNA negative-strand viruses; Mononegavirales; Paramyxoviridae; Rubulavirus
Taxonomy
Organism
vg  Viruses (Human rubulavirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
Position
NC_003443:6817..8532
AA seq 571 aa AA seqDB search
MEDYSNLSLKSIPKRTCRIIFRTATILGICTLIVLCSSILHEIIHLDVSSGLMDSDDSQQ
GIIQPIIESLKSLIALANQILYNVAIIIPLKIDSIETVIFSALKDMHTGSMSNTNCTPGN
LLLHDAAYINGINKFLVLKSYNGTPKYGPLLNIPSFIPSATSPNGCTRIPSFSLIKTHWC
YTHNVMLGDCLDFTTSNQYLAMGIIQQSAAAFPIFRTMKTIYLSDGINRKSCSVTAIPGG
CVLYCYVATRSEKEDYATTDLAELRLAFYYYNDTFIERVISLPNTTGQWATINPAVGSGI
YHLGFILFPVYGGLISGTPSYNKQSSRYFIPKHPNITCAGNSSEQAAAARSSYVIRYHSN
RLIQSAVLICPLSDMHTARCNLVMFNNSQVMMGAEGRLYVIDNNLYYYQRSSSWWSASLF
YRINTDFSKGIPPIIEAQWVPSYQVPRPGVMPCNATSFCPANCITGVYADVWPLNDPEPT
SQNALNPNYRFAGAFLRNESNRTNPTFYTASASALLNTTGFNNTNHKAAYTSSTCFKNTG
TQKIYCLIIIEMGSSLLGEFQIIPFLRELIP
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaagattacagcaatctatctcttaaatcaattcctaaaaggacatgtagaatcatt
ttccgaactgccacaattcttggaatatgcacattgattgttctatgttcaagtattctt
catgagataattcatcttgatgtttcctctggtctcatggattccgatgattcacagcaa
ggcattattcagcctattatagaatcattaaaatcattaattgctttggctaaccagatt
ctgtacaatgttgcaataataattcctcttaaaattgacagtatcgagactgtaatattc
tctgctttaaaggatatgcatactgggagcatgtccaacaccaactgtacacccggaaat
ctgcttctgcatgatgcagcgtacatcaatggaataaacaaattccttgtacttaaatca
tacaatgggacgcctaaatatggacctctcctaaatattcccagctttatcccctcagca
acatctcccaacgggtgcactagaataccatcattttcactcattaagacccattggtgt
tacactcacaatgtaatgcttggagattgcctcgatttcacgacatctaatcagtattta
gcaatggggataatacaacaatctgctgcagcatttccaatcttcaggactatgaaaacc
atttacctaagtgatggaatcaatcgcaaaagctgttcagtcactgctataccaggaggt
tgtgtcttgtattgctatgtagctacaagatctgagaaagaagattatgccacaactgat
ctagctgaactgagacttgctttctattattataatgatacctttattgaaagagtcata
tctcttccaaatacaacagggcaatgggccacaatcaatcctgcagttggaagcgggatc
tatcatctaggctttatcttatttcctgtatatggtggtctcataagtgggactccttcc
tacaacaagcagtcctcacgctattttatcccaaaacatcccaacataacctgtgccggt
aactccagcgaacaggctgcagcagcacggagttcctatgtaatccgttatcactcaaac
aggttgattcagagtgctgttcttatttgcccattgtctgacatgcacacagcaaggtgt
aatctagttatgtttaacaattctcaagtcatgatgggtgcagaaggtaggctctatgtt
attgacaataatttgtattattatcaacgtagttcctcttggtggtctgcatcgcttttt
tacaggatcaatacagatttttctaaaggaattcctcctatcattgaggctcaatgggta
ccgtcctatcaagttccccgtcctggagtcatgccatgcaatgcaacaagtttttgccct
gctaattgcatcacaggggtgtacgcagatgtgtggccgcttaacgatccagaacccaca
tcacaaaatgctctgaatcccaactatcgatttgctggagcctttctcagaaatgagtcc
aaccgaaccaatcccacattctacactgcatcagccagcgccctactaaatactaccgga
ttcaacaacaccaatcacaaagcagcatatacgtcttcaacctgctttaagaatactgga
actcaaaagatttattgtttgataataattgaaatgggctcatctcttttaggggagttc
caaataataccatttctaagggaactaataccttaa

DBGET integrated database retrieval system