GenomeNet

Database: VGENES
Entry: NC_007363_1
LinkDB: NC_007363_1
ENTRY       NC_007363_1       CDS       Virus
NAME        M2, FLUAVH5N1_s7gp1
DEFINITION  Influenza A virus (A/goose/Guangdong/1/1996(H5N1)); matrix protein 2
POSITION    join(26..51,740..1007)
DBLINKS     VGNM: NC_007363
            RS: NC_007363
            NCBI-GI: 73852958
            NCBI-GeneID: 3654621
CODON_USAGE       T               C               A               G
          T   1   2   0   3   2   0   1   0   2   1   1   0   0   3   0   2
          C   5   0   1   2   4   0   0   0   1   1   0   3   2   1   0   1
          A   3   1   3   2   0   2   0   2   0   2   5   0   4   1   1   1
          G   3   2   1   1   1   1   1   0   5   1   5   6   2   0   0   3
AASEQ       97
            MSLLTEVETPTKNEWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK
            RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE
NTSEQ       294
            atgagtcttctaaccgaggtcgaaacgcctaccaaaaacgaatgggagtgcaaatgcagc
            gattcaagtgatcctcttgttgttgccgcaagtatcattgggatactgcacttgatattg
            tggattcttgatcgtcttttcttcaaatgcatttatcgtcgccttaaatacggtttgaaa
            agagggccttctacggaaggggtacctgagtctatgagggaagagtatcggcaggaacag
            cagagtgctgtggatgttgacgatggtcattttgtcaacatagagctggagtaa
///
DBGET integrated database retrieval system