KEGG   Vibrio campbellii: VIBHAR_00145Help
Entry
VIBHAR_00145      CDS       T00589                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vha  Vibrio campbellii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_00145
   01230 Biosynthesis of amino acids
    VIBHAR_00145
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_00145
   00030 Pentose phosphate pathway
    VIBHAR_00145
   00051 Fructose and mannose metabolism
    VIBHAR_00145
   00052 Galactose metabolism
    VIBHAR_00145
  Energy metabolism
   00680 Methane metabolism
    VIBHAR_00145
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VIBHAR_00145
Protein phosphatases and associated proteins [BR:vha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VIBHAR_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(143952..144914)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAVRGVVRTALSEGLEVYGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKEVEVREQAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKDKLIKNIQDGIAKGKKHAIIALTELMMDANELAREIEAATG
RETRATVLGHIQRGGRPAAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRSDLYQVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgctgca
gtacgcggcgtagttcgtacagcactatctgagggattggaagtttacggtgtttacgat
ggctacctaggtctatacgaaggccgcatcgagaagctagatcgttctagcgtttcagat
gtgatcaacaaaggtggtacattcctaggctctgctcgcttccctgaattcaaggaagtg
gaagtacgcgaacaagcgattgagaacctgaaaaaacacggtatcgatgcactagttgtt
atcggtggtgacggttcttacatgggtgctaagaagctgactgaaatgggttatccatgt
atcggtctaccaggcacaatcgataacgacatcgcaggtacagattacacaatcggttac
ctaactgcactaaacacagttatcgatgcaatcgaccgtctacgcgacacgtcctcttct
catcagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctgactctgatg
tctgcaatcgcaggtggttgtgagtacatcattacgccagaaacaggcctagataaagac
aagttaatcaaaaatatccaagacggcatcgctaaaggtaagaagcacgcaattatcgca
ctaactgagctgatgatggatgcaaacgaactagcgagagagattgaagcggcgactggt
cgtgaaactcgcgcaacggttcttggccacatccagcgtggtggtcgtccagctgcattt
gatcgtgttctagcatctcgcatgggtaactacgccgttcacttgctaatggaaggccat
ggcggccgttgtgttggtatcgtgaaagagcaactggttcaccacgacatcatcgatgca
atcgagaacatgaaacgtccagtacgcagcgacctataccaagttgctgaagagctattc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system