KEGG   Vibrio campbellii: VIBHAR_00169Help
Entry
VIBHAR_00169      CDS       T00589                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vha  Vibrio campbellii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_00169
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_00169
   00620 Pyruvate metabolism
    VIBHAR_00169
   00640 Propanoate metabolism
    VIBHAR_00169
  Energy metabolism
   00680 Methane metabolism
    VIBHAR_00169
Enzymes [BR:vha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VIBHAR_00169
Lipid biosynthesis proteins [BR:vha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VIBHAR_00169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:171651..173699
Genome map
AA seq 682 aa AA seqDB search
MHSNVLYESQTKERKQPHKRRRSRIKGTRREAMSEAHVYPVKENIKNHTHADNDTYLAMY
QQSVSDPEGFWSEHGKVVDWIKPFTRVKNTSFDTGHVDIRWFEDGTLNVSANCIDRHLAE
RGDEVAIIWEGDDPADDKTLTFNELHKEVCQFSNALKEQGVHKGDVVCLYMPMVPEAAIA
MLACTRIGAVHTVVFGGFSPEALSGRIIDSDAKIVITADEGVRGGRAVPLKKNVDEALTN
PEVKTIDKVVVLKRTGSDIDWHEHRDVWWHEATAVVSDVCPPEEMKAEDPLFILYTSGST
GKPKGVLHTTGGYLVYATMTFKYVFDYQEGETFWCTADVGWITGHTYLIYGPLANGAKTI
LFEGVPNYPSTARMSEVVDKHQVNILYTAPTAIRALMAKGNEAVAGTSRSSLRVMGSVGE
PINPEAWEWYYKTIGNENSPIVDTWWQTETGGILIAPLPGATDLKPGSATRPFFGVQPAL
VDNMGNIIEETAAEGNLVILDSWPGQMRTVYGDHERFEQTYFSTFKGMYFTSDGARRDED
GYYWITGRVDDVLSVSGHRMGTAEIESALVAHDKIAEAAIVGIPHDIKGQAIYAYVTLND
GEFPSAELHKEVKDWVRKEIGPIATPDVLHWTDSLPKTRSGKIMRRILRKIATGDTSNLG
DTSTLADPSVVDKLIAEKAELA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcaacgttctttatgaatcacagacgaaagaacggaaacagccccacaaaaga
cgaaggtcgagaattaaaggcacaaggagagaagccatgagcgaagcccacgtttatccg
gtaaaagaaaacattaaaaaccatacgcatgcggataatgacacttacctagccatgtat
cagcagtcggtaagcgaccctgaaggcttctggagcgaacacggtaaagttgtcgattgg
attaagccattcactcgagttaaaaacacctcgttcgatactggtcacgtcgacattcgt
tggttcgaagacggcacgctgaacgtatctgcaaactgtattgaccgccaccttgccgag
cgtggcgatgaagtcgcgatcatctgggaaggcgatgatcctgccgacgacaaaaccctc
acattcaatgaactgcacaaagaagtgtgtcagttctctaacgcactaaaagaacaaggc
gtgcacaaaggcgacgtggtttgtctttacatgccaatggtgccagaagcggctatcgca
atgctggcatgtacgcgtattggtgcggttcataccgtggtatttggtggtttctcgcca
gaagccctgtccggtcgtatcatcgactcagatgcgaaaatcgttatcactgctgacgaa
ggcgttcgtggtggtcgcgcagtaccactgaagaaaaacgttgatgaagcactgacaaac
ccagaagtaaaaaccatcgacaaagttgtcgttctaaaacgcacgggcagtgatattgat
tggcacgagcaccgtgacgtttggtggcacgaagcaacggctgttgtttctgacgtatgt
ccaccagaagagatgaaagcggaagaccctctgttcattctgtacacttcaggctcaaca
ggtaagccaaaaggcgtgctgcacaccacaggtggttacctagtgtacgcgaccatgacc
ttcaagtacgtgttcgattaccaagaaggtgaaacgttctggtgtacggcggatgtgggt
tggattacgggtcacacttacttaatttacggtccactggcgaacggtgcgaaaaccatt
ctgttcgaaggtgtaccaaactacccaagcacggctcgcatgagtgaagtggttgataag
catcaagtaaacattctctacactgcaccaacagcgattcgcgccctaatggcgaaaggt
aacgaagcggtagccggaacctctcgttcaagtttgcgtgtaatgggctcagtaggtgaa
cctatcaaccctgaagcatgggagtggtactacaagaccatcggtaatgaaaactcaccg
atcgttgatacttggtggcaaacagagacaggcggtatcttgattgcgccactaccggga
gcaacagacctgaaaccaggttctgcaactcgcccattcttcggcgtacaacctgcactc
gtagataacatgggtaacatcatcgaagaaaccgctgcagaaggtaacttggtgatcctt
gattcatggccaggtcagatgcgtactgtttacggtgaccacgagcgctttgagcaaacc
tacttctctaccttcaaaggcatgtacttcaccagtgatggtgctcgtcgtgacgaagat
ggctattactggatcacaggtcgtgtagatgacgtattgagcgtctcaggtcaccgaatg
ggtaccgcagagattgagtcagcactggttgcacacgataagattgcggaagcagcgatt
gtcggtatccctcatgacatcaaaggtcaggcaatttacgcatacgtcacgcttaatgat
ggtgaattcccatcagctgagctgcacaaagaggtgaaagactgggtacgtaaagagatt
ggcccaatcgcaacgccagacgtactgcactggacagactctctaccaaaaacacgctcc
ggtaaaatcatgcgtcgcatcctacgtaagattgcaacgggtgataccagcaacctaggt
gatacttcaacactggccgatccaagtgttgtagacaagctaattgcagagaaggcagaa
ctggcataa

DBGET integrated database retrieval system