KEGG   Vibrio campbellii: VIBHAR_00169Help
Entry
VIBHAR_00169      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vha  Vibrio campbellii
Pathway
vha00010  Glycolysis / Gluconeogenesis
vha00620  Pyruvate metabolism
vha00640  Propanoate metabolism
vha00680  Methane metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
vha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_00169
   00620 Pyruvate metabolism
    VIBHAR_00169
   00640 Propanoate metabolism
    VIBHAR_00169
  Energy metabolism
   00680 Methane metabolism
    VIBHAR_00169
Enzymes [BR:vha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VIBHAR_00169
Lipid biosynthesis proteins [BR:vha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VIBHAR_00169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABU69217
UniProt: A7MXI1
Position
I:171651..173699
Genome map
AA seq 682 aa AA seqDB search
MHSNVLYESQTKERKQPHKRRRSRIKGTRREAMSEAHVYPVKENIKNHTHADNDTYLAMY
QQSVSDPEGFWSEHGKVVDWIKPFTRVKNTSFDTGHVDIRWFEDGTLNVSANCIDRHLAE
RGDEVAIIWEGDDPADDKTLTFNELHKEVCQFSNALKEQGVHKGDVVCLYMPMVPEAAIA
MLACTRIGAVHTVVFGGFSPEALSGRIIDSDAKIVITADEGVRGGRAVPLKKNVDEALTN
PEVKTIDKVVVLKRTGSDIDWHEHRDVWWHEATAVVSDVCPPEEMKAEDPLFILYTSGST
GKPKGVLHTTGGYLVYATMTFKYVFDYQEGETFWCTADVGWITGHTYLIYGPLANGAKTI
LFEGVPNYPSTARMSEVVDKHQVNILYTAPTAIRALMAKGNEAVAGTSRSSLRVMGSVGE
PINPEAWEWYYKTIGNENSPIVDTWWQTETGGILIAPLPGATDLKPGSATRPFFGVQPAL
VDNMGNIIEETAAEGNLVILDSWPGQMRTVYGDHERFEQTYFSTFKGMYFTSDGARRDED
GYYWITGRVDDVLSVSGHRMGTAEIESALVAHDKIAEAAIVGIPHDIKGQAIYAYVTLND
GEFPSAELHKEVKDWVRKEIGPIATPDVLHWTDSLPKTRSGKIMRRILRKIATGDTSNLG
DTSTLADPSVVDKLIAEKAELA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcaacgttctttatgaatcacagacgaaagaacggaaacagccccacaaaaga
cgaaggtcgagaattaaaggcacaaggagagaagccatgagcgaagcccacgtttatccg
gtaaaagaaaacattaaaaaccatacgcatgcggataatgacacttacctagccatgtat
cagcagtcggtaagcgaccctgaaggcttctggagcgaacacggtaaagttgtcgattgg
attaagccattcactcgagttaaaaacacctcgttcgatactggtcacgtcgacattcgt
tggttcgaagacggcacgctgaacgtatctgcaaactgtattgaccgccaccttgccgag
cgtggcgatgaagtcgcgatcatctgggaaggcgatgatcctgccgacgacaaaaccctc
acattcaatgaactgcacaaagaagtgtgtcagttctctaacgcactaaaagaacaaggc
gtgcacaaaggcgacgtggtttgtctttacatgccaatggtgccagaagcggctatcgca
atgctggcatgtacgcgtattggtgcggttcataccgtggtatttggtggtttctcgcca
gaagccctgtccggtcgtatcatcgactcagatgcgaaaatcgttatcactgctgacgaa
ggcgttcgtggtggtcgcgcagtaccactgaagaaaaacgttgatgaagcactgacaaac
ccagaagtaaaaaccatcgacaaagttgtcgttctaaaacgcacgggcagtgatattgat
tggcacgagcaccgtgacgtttggtggcacgaagcaacggctgttgtttctgacgtatgt
ccaccagaagagatgaaagcggaagaccctctgttcattctgtacacttcaggctcaaca
ggtaagccaaaaggcgtgctgcacaccacaggtggttacctagtgtacgcgaccatgacc
ttcaagtacgtgttcgattaccaagaaggtgaaacgttctggtgtacggcggatgtgggt
tggattacgggtcacacttacttaatttacggtccactggcgaacggtgcgaaaaccatt
ctgttcgaaggtgtaccaaactacccaagcacggctcgcatgagtgaagtggttgataag
catcaagtaaacattctctacactgcaccaacagcgattcgcgccctaatggcgaaaggt
aacgaagcggtagccggaacctctcgttcaagtttgcgtgtaatgggctcagtaggtgaa
cctatcaaccctgaagcatgggagtggtactacaagaccatcggtaatgaaaactcaccg
atcgttgatacttggtggcaaacagagacaggcggtatcttgattgcgccactaccggga
gcaacagacctgaaaccaggttctgcaactcgcccattcttcggcgtacaacctgcactc
gtagataacatgggtaacatcatcgaagaaaccgctgcagaaggtaacttggtgatcctt
gattcatggccaggtcagatgcgtactgtttacggtgaccacgagcgctttgagcaaacc
tacttctctaccttcaaaggcatgtacttcaccagtgatggtgctcgtcgtgacgaagat
ggctattactggatcacaggtcgtgtagatgacgtattgagcgtctcaggtcaccgaatg
ggtaccgcagagattgagtcagcactggttgcacacgataagattgcggaagcagcgatt
gtcggtatccctcatgacatcaaaggtcaggcaatttacgcatacgtcacgcttaatgat
ggtgaattcccatcagctgagctgcacaaagaggtgaaagactgggtacgtaaagagatt
ggcccaatcgcaacgccagacgtactgcactggacagactctctaccaaaaacacgctcc
ggtaaaatcatgcgtcgcatcctacgtaagattgcaacgggtgataccagcaacctaggt
gatacttcaacactggccgatccaagtgttgtagacaagctaattgcagagaaggcagaa
ctggcataa

DBGET integrated database retrieval system