KEGG   Vibrio campbellii: VIBHAR_00300Help
Entry
VIBHAR_00300      CDS       T00589                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vha  Vibrio campbellii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VIBHAR_00300
Enzymes [BR:vha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VIBHAR_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:287522..288511
Genome map
AA seq 329 aa AA seqDB search
MAINHSPLTYTQETLFEQAIGGPIAALWQERQEGFVKGTEKKKIYWCRLTNPEHTKAVLI
VNGRIEASWKYQELFYDLYRQGYDVYSFDHRGQGLSDRLIPDSDMGHVYDFNDYIEDMEL
VLQQLDLSGYQQRFIIAHSMGGAIATRYLQTHPEHNFDGLILSSPMFGINLPWYLSPIAI
PVSQILAAVSTKPSYAPGHKEYYPKPFEDNPLSQSYDRYHWFRGLYRDKPELQVGGPSTR
WVWQGLMAAKQCILLTRQIKVPVLLVQSGNDRIVSNAAQQRFIDKLSKTNPNASLVSIAG
AEHEILFEKDQYRNQALDAIFSFMRAQSA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctattaaccattcacctttgacttatactcaagagactttatttgagcaagcaata
ggtggtccgatcgcagcactttggcaagagcgccaagaaggctttgtaaaagggacagag
aaaaagaaaatctactggtgcagacttaccaatcctgagcacacaaaagccgtgctgatc
gtcaacggtcgcattgaagcttcctggaaataccaagaactgttctatgacctatatcga
caaggttatgacgtgtattcgtttgaccatcgaggacaaggtttatcagatcgcctaatt
ccagactcagacatgggtcacgtctatgactttaatgactacattgaagatatggaattg
gtgctgcaacagcttgatttaagcggataccaacagcgttttatcattgctcactcaatg
ggtggcgcaatcgctacgcgctacctgcaaacgcatccagaacacaactttgatggtttg
attctgagttccccaatgtttggtatcaacctaccttggtatctcagccctatcgcgatt
ccggtcagccaaatcttagcggcagtctcgacaaagccaagctacgcgccgggtcataaa
gaatactacccaaaaccgtttgaagataacccacttagccaaagctacgatcgttatcat
tggttccgtggtttataccgtgacaaacccgagctgcaagtcggtgggccaagcacccgc
tgggtttggcaaggtttaatggctgccaagcaatgcattttgctgactcgccaaattaaa
gttccggttttattggttcagtcaggcaacgatcgcatcgtgagtaacgccgcgcagcaa
cgctttatcgataagctaagtaagaccaaccctaatgccagcctagtttcgattgctggt
gcagagcacgaaattttgttcgaaaaagaccagtatcgtaaccaagctctggacgctatc
ttttcctttatgcgtgctcaaagcgcataa

DBGET integrated database retrieval system