KEGG   Vibrio harveyi: VIBHAR_00300Help
Entry
VIBHAR_00300      CDS       T00589                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vha  Vibrio harveyi
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vha00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:287522..288511
Genome map
AA seq 329 aa AA seqDB search
MAINHSPLTYTQETLFEQAIGGPIAALWQERQEGFVKGTEKKKIYWCRLTNPEHTKAVLI
VNGRIEASWKYQELFYDLYRQGYDVYSFDHRGQGLSDRLIPDSDMGHVYDFNDYIEDMEL
VLQQLDLSGYQQRFIIAHSMGGAIATRYLQTHPEHNFDGLILSSPMFGINLPWYLSPIAI
PVSQILAAVSTKPSYAPGHKEYYPKPFEDNPLSQSYDRYHWFRGLYRDKPELQVGGPSTR
WVWQGLMAAKQCILLTRQIKVPVLLVQSGNDRIVSNAAQQRFIDKLSKTNPNASLVSIAG
AEHEILFEKDQYRNQALDAIFSFMRAQSA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctattaaccattcacctttgacttatactcaagagactttatttgagcaagcaata
ggtggtccgatcgcagcactttggcaagagcgccaagaaggctttgtaaaagggacagag
aaaaagaaaatctactggtgcagacttaccaatcctgagcacacaaaagccgtgctgatc
gtcaacggtcgcattgaagcttcctggaaataccaagaactgttctatgacctatatcga
caaggttatgacgtgtattcgtttgaccatcgaggacaaggtttatcagatcgcctaatt
ccagactcagacatgggtcacgtctatgactttaatgactacattgaagatatggaattg
gtgctgcaacagcttgatttaagcggataccaacagcgttttatcattgctcactcaatg
ggtggcgcaatcgctacgcgctacctgcaaacgcatccagaacacaactttgatggtttg
attctgagttccccaatgtttggtatcaacctaccttggtatctcagccctatcgcgatt
ccggtcagccaaatcttagcggcagtctcgacaaagccaagctacgcgccgggtcataaa
gaatactacccaaaaccgtttgaagataacccacttagccaaagctacgatcgttatcat
tggttccgtggtttataccgtgacaaacccgagctgcaagtcggtgggccaagcacccgc
tgggtttggcaaggtttaatggctgccaagcaatgcattttgctgactcgccaaattaaa
gttccggttttattggttcagtcaggcaacgatcgcatcgtgagtaacgccgcgcagcaa
cgctttatcgataagctaagtaagaccaaccctaatgccagcctagtttcgattgctggt
gcagagcacgaaattttgttcgaaaaagaccagtatcgtaaccaagctctggacgctatc
ttttcctttatgcgtgctcaaagcgcataa

DBGET integrated database retrieval system