KEGG   Vibrio harveyi: VIBHAR_00315Help
Entry
VIBHAR_00315      CDS       T00589                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vha  Vibrio harveyi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VIBHAR_00315 (hemD)
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VIBHAR_00315 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:303875..304603
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPGEQGAALCSLLERHGKTAIHHPLIDIVADLSDTQLSKYIETAQIIIAVSQHA
VQCAEQILQNHAKSWSKQAVYLAVGQKTAHYLSKCTQQKVHYPQVSDSEHLLQLPELNNV
EKQTVLILRGNGGRELIKDALVRRGAKVHYSETYKREFIPFDPVSCVSLWKTQQIDQIIV
TSGEQLDYLCSQLTSEQLTWLNQQELYIPSQRIADIAIQRGFTQVRCTGSASNQELLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgttggtcactcgtccgggagagcaaggcgcggcgctttgctctctgctcgaa
aggcacggcaaaactgcaattcatcatcctctgatcgacatcgtcgccgatctcagcgac
acacaactctccaaatacattgaaaccgctcaaatcattattgctgttagccagcatgcg
gtgcaatgcgcggagcaaatcttgcagaaccacgctaaatcatggtctaagcaggctgta
taccttgccgttggtcaaaaaacagcacactatttaagcaaatgtacccaacaaaaagta
cactatccacaagtcagtgatagtgagcacttgttgcagctacccgagctaaacaatgta
gaaaaacaaacagttctgatcctccgtggcaacggcggtagagagctgataaaagatgca
ttggtgagacgtggagcaaaagttcactatagtgagacttataagagagaatttatccca
ttcgatccagtaagctgtgtctcactatggaaaacccaacaaatcgaccagattatcgtc
accagtggtgaacaactggattatttgtgcagccaattgacgtcagagcaattgacttgg
cttaatcaacaagagttgtatatccccagtcagcgaatcgctgacatcgcaattcaacgg
ggcttcactcaggtcaggtgcacaggaagcgcatccaaccaagaattactggctgctctc
cagccctag

DBGET integrated database retrieval system