KEGG   Vibrio campbellii: VIBHAR_00315Help
Entry
VIBHAR_00315      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vha  Vibrio campbellii
Pathway
vha00860  Porphyrin and chlorophyll metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VIBHAR_00315
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VIBHAR_00315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PIG-H Phage_holin_6_1
Motif
Other DBs
NCBI-ProteinID: ABU69343
UniProt: A7MXU5
Position
I:303875..304603
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPGEQGAALCSLLERHGKTAIHHPLIDIVADLSDTQLSKYIETAQIIIAVSQHA
VQCAEQILQNHAKSWSKQAVYLAVGQKTAHYLSKCTQQKVHYPQVSDSEHLLQLPELNNV
EKQTVLILRGNGGRELIKDALVRRGAKVHYSETYKREFIPFDPVSCVSLWKTQQIDQIIV
TSGEQLDYLCSQLTSEQLTWLNQQELYIPSQRIADIAIQRGFTQVRCTGSASNQELLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgttggtcactcgtccgggagagcaaggcgcggcgctttgctctctgctcgaa
aggcacggcaaaactgcaattcatcatcctctgatcgacatcgtcgccgatctcagcgac
acacaactctccaaatacattgaaaccgctcaaatcattattgctgttagccagcatgcg
gtgcaatgcgcggagcaaatcttgcagaaccacgctaaatcatggtctaagcaggctgta
taccttgccgttggtcaaaaaacagcacactatttaagcaaatgtacccaacaaaaagta
cactatccacaagtcagtgatagtgagcacttgttgcagctacccgagctaaacaatgta
gaaaaacaaacagttctgatcctccgtggcaacggcggtagagagctgataaaagatgca
ttggtgagacgtggagcaaaagttcactatagtgagacttataagagagaatttatccca
ttcgatccagtaagctgtgtctcactatggaaaacccaacaaatcgaccagattatcgtc
accagtggtgaacaactggattatttgtgcagccaattgacgtcagagcaattgacttgg
cttaatcaacaagagttgtatatccccagtcagcgaatcgctgacatcgcaattcaacgg
ggcttcactcaggtcaggtgcacaggaagcgcatccaaccaagaattactggctgctctc
cagccctag

DBGET integrated database retrieval system