KEGG   Vibrio harveyi: VIBHAR_00570Help
Entry
VIBHAR_00570      CDS       T00589                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vha  Vibrio harveyi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vha00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:552213..553196
Genome map
AA seq 327 aa AA seqDB search
MAENQVSVNDLIYPMFILMGKDRRESVESMPGVERLSIDLMLEEAQYLANLGVPAIALFP
VVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQIGVITDVALDPFTTHGQDGIIDEDGY
VMNDETTEVLVKQALSHAEAGADVVAPSDMMDGRIGKIREALEEAGHIHTQIMAYSAKYA
SNYYGPFRDAVGSSANLKGGNKKNYQMDPANTDEALHEVALDINEGADMVMVKPGMPYLD
VVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWLKERETVMESLLCFKRAGADGILTYFA
KDVAEWLAEENAQTAEHLVKAQEATDE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaccaagtttcagtaaacgatttgatttacccaatgttcatcctgatgggc
aaagatcgtcgtgaaagtgttgaatcgatgccgggtgtagaacgtttgtcgattgattta
atgctagaagaagcccaatacctagcaaacttaggcgtaccagcaatcgcgcttttccct
gtcgtaaaccaagacgctaaaagtttatgtgctgctgaagcttacaacccagaaggtttg
gttcagcgcgcagtacgtgcattaaaagagcacgtgcctcaaatcggcgtgatcacagat
gtggcactcgacccattcactacacatggccaagatggcatcatcgatgaagatggctat
gtaatgaatgatgagacaactgaagtacttgtaaaacaagcgctgtctcatgcagaagcg
ggtgcagatgtggttgcaccatcagacatgatggatggtcgtattggtaaaatccgtgaa
gcactagaagaagcgggccacatccatactcagatcatggcttactctgcgaagtacgca
tcaaactactacggtccattccgtgacgcagttggttcatcagcgaacctaaaaggcggc
aacaagaaaaactaccaaatggatcctgcgaatacggatgaagcgctacatgaagtggct
ctcgacatcaatgaaggtgcggatatggtcatggttaagccagggatgccttaccttgat
gtggttcgccgcgtgaagactgagcttcaagttccaaccttcgcttaccaagtctctggt
gagtacgcgatgcataaagcagccatcatgaatggttggctaaaagagcgcgagaccgtg
atggaatcgcttctttgcttcaagcgtgcaggtgctgatggcatcctgacttacttcgcg
aaagatgtagcagaatggctagcggaagaaaacgcacaaactgcagagcacttagtgaaa
gcgcaagaagcgacagacgagtaa

DBGET integrated database retrieval system