KEGG   Vibrio campbellii: VIBHAR_00570Help
Entry
VIBHAR_00570      CDS       T00589                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vha  Vibrio campbellii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VIBHAR_00570
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VIBHAR_00570
Exosome [BR:vha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VIBHAR_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:552213..553196
Genome map
AA seq 327 aa AA seqDB search
MAENQVSVNDLIYPMFILMGKDRRESVESMPGVERLSIDLMLEEAQYLANLGVPAIALFP
VVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQIGVITDVALDPFTTHGQDGIIDEDGY
VMNDETTEVLVKQALSHAEAGADVVAPSDMMDGRIGKIREALEEAGHIHTQIMAYSAKYA
SNYYGPFRDAVGSSANLKGGNKKNYQMDPANTDEALHEVALDINEGADMVMVKPGMPYLD
VVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWLKERETVMESLLCFKRAGADGILTYFA
KDVAEWLAEENAQTAEHLVKAQEATDE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaccaagtttcagtaaacgatttgatttacccaatgttcatcctgatgggc
aaagatcgtcgtgaaagtgttgaatcgatgccgggtgtagaacgtttgtcgattgattta
atgctagaagaagcccaatacctagcaaacttaggcgtaccagcaatcgcgcttttccct
gtcgtaaaccaagacgctaaaagtttatgtgctgctgaagcttacaacccagaaggtttg
gttcagcgcgcagtacgtgcattaaaagagcacgtgcctcaaatcggcgtgatcacagat
gtggcactcgacccattcactacacatggccaagatggcatcatcgatgaagatggctat
gtaatgaatgatgagacaactgaagtacttgtaaaacaagcgctgtctcatgcagaagcg
ggtgcagatgtggttgcaccatcagacatgatggatggtcgtattggtaaaatccgtgaa
gcactagaagaagcgggccacatccatactcagatcatggcttactctgcgaagtacgca
tcaaactactacggtccattccgtgacgcagttggttcatcagcgaacctaaaaggcggc
aacaagaaaaactaccaaatggatcctgcgaatacggatgaagcgctacatgaagtggct
ctcgacatcaatgaaggtgcggatatggtcatggttaagccagggatgccttaccttgat
gtggttcgccgcgtgaagactgagcttcaagttccaaccttcgcttaccaagtctctggt
gagtacgcgatgcataaagcagccatcatgaatggttggctaaaagagcgcgagaccgtg
atggaatcgcttctttgcttcaagcgtgcaggtgctgatggcatcctgacttacttcgcg
aaagatgtagcagaatggctagcggaagaaaacgcacaaactgcagagcacttagtgaaa
gcgcaagaagcgacagacgagtaa

DBGET integrated database retrieval system