KEGG   Vibrio campbellii: VIBHAR_00612Help
Entry
VIBHAR_00612      CDS       T00589                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vha  Vibrio campbellii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VIBHAR_00612
Enzymes [BR:vha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VIBHAR_00612
Transfer RNA biogenesis [BR:vha03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VIBHAR_00612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(597135..597962)
Genome map
AA seq 275 aa AA seqDB search
MPMTKDLSHLLPQVIEIARSAGQLILDIYEKKQYEAYTKSDETPVTSADIAAHKLITERL
SELTPDIPVLSEEAADISLEQRAQWERYWLVDPLDGTQEFIARSGDFATIIALIDNNKPT
MGVVYGPVSGVTYYAYNGKGAWKIPDMSESVKIHTHKHEQPGQNIAIAISRRQDINRITS
RMSSAWNYDLIPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQ
LEPLSYNERETLENPNFIVLGDADLPWDEILQRKD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgacaaaagatttatctcacctgctcccgcaagtcatcgaaattgctcgcagc
gcgggacaattgattctcgatatttacgagaaaaagcagtacgaagcttacaccaaaagt
gacgagaccccagtcaccagtgctgatatcgcagcgcacaagctgatcaccgagcgttta
agcgagcttacgccagatatccccgtgctttctgaagaagccgcggacatcagcttagag
caacgtgcgcaatgggaacgctactggttggttgacccacttgatggtacacaagagttc
atcgcgcgcagcggtgacttcgcgaccattatcgcccttatcgacaacaataagccaacc
atgggtgtggtttacggtccagtttctggcgtgacttattatgcatacaacggcaagggc
gcgtggaagattccagacatgtctgagagcgtgaaaatccacactcacaaacatgaacag
cctgggcaaaacatcgctatcgcaatcagccgtcgccaagacatcaaccgcatcacgagc
cgcatgagtagcgcttggaattacgatttgattccactcggctctgccgcacttaaagca
tgccttgtcgctgaaggtgcagtggactgttatttacgtctaggtccaactggcgagtgg
gataccgctgctacacaatgcattgtagaagaagcgggcggacgaattctcagtacgcaa
cttgaaccgctgtcttacaatgagcgcgagacgttggagaacccaaactttatcgtactg
ggtgacgcggatttgccatgggatgagattctccagcgcaaagactga

DBGET integrated database retrieval system