KEGG   Vibrio campbellii: VIBHAR_00805Help
Entry
VIBHAR_00805      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vha  Vibrio campbellii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VIBHAR_00805
   00670 One carbon pool by folate
    VIBHAR_00805
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VIBHAR_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:786999..787478
Genome map
AA seq 159 aa AA seqDB search
MIISMIAAMADNRIIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYESIGRPLPGRLN
IVISRDASLSIEGVTTVTSIEQALEIAGEVEEVMIIGGGAIYAACLPMANKLYVTHIEAE
IEGDTQFPDWGNEFKETYSEAYQADEKNAYNMRFTVLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcagcatgattgccgcgatggcagacaaccgaatcatcggtaaagacaaccag
atgccttggcatcttccggcagattttgcatggtttaagcgctgtacaatgggtaagcct
gttgtgatgggacgtaaaacttatgaatcaatcggacgtcctttacctggccgtttgaat
attgtcatcagccgtgatgcttcactttccattgaaggtgtcacgaccgttacgtcgatc
gagcaagcgcttgagattgctggtgaagtggaagaagtgatgatcattggtggtggagcg
atttatgctgcgtgtttaccgatggctaacaaactgtatgtcacgcatattgaagccgaa
attgagggcgatactcagttccctgattgggggaatgagtttaaggaaacatactctgaa
gcgtatcaagcggatgagaaaaacgcttacaacatgcgttttaccgttctagaaaagtaa

DBGET integrated database retrieval system