KEGG   Vibrio campbellii: VIBHAR_00941Help
Entry
VIBHAR_00941      CDS       T00589                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vha  Vibrio campbellii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VIBHAR_00941
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBHAR_00941
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VIBHAR_00941
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VIBHAR_00941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:945682..946962
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELPKFEDVDALLAEDFVSRSTKILSAL
IGDELAEEQVNALVDAAFQFPAPINQVKDDVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
DGDFDACQALVKQAFDDSALREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGQWAPKPTVATKSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYALGYLCEPHGAIAYRVLE
EQLQEGETGLFLCTAHPAKFKEVVDDILESDIDLPAPLAKHAAMELLSEDLDADFDALKQ
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaatataaaagaaaatgatgaacaagtttcctttggccaagccgttcgc
caaggattaggccgtaaccaaggtctatttttcccatcggaattaccaaaatttgaagat
gttgatgcgctgctggcagaagactttgtttctcgtagcacgaaaatcctatcagcactg
attggcgatgagttggcggaagagcaagttaacgcattggttgacgctgcattccaattc
ccagcaccaatcaaccaagtaaaagacgatgtttacgctctggagcttttccatggtcca
acgcttgcgtttaaagactttggtggtcgctttatggcgcaatctcttgcggcagtttcg
gacggtggcaagatcactatcctaacggcaacttctggcgatactggcgcagccgttgcg
cacgctttctatggtatggaagacatcaacgttgtgattctgtatccgaaaggcaaaatc
agcccattgcaagagaagctattctgtacgcttggtaagaacatccatactgtcgcgatc
gatggagacttcgatgcgtgtcaggctctggttaagcaagcttttgatgattctgcactg
cgtgaagagatcggtctcaactctgcaaactcaatcaacatcagccgtttgatggcgcaa
atctgttactactttgaagcagctgcgcaaatgagcaaacaagagcgtgaaaacctagtg
gtatcagtaccaagcggtaacttcggtaacctaactgctggcctactggcaaaagcactg
ggtctgcctattaagcgcttcatcgctgcaacgaatgccaatgacactgtgccacgttac
ctagaaacgggtcagtgggcgccgaaaccaacggttgcaacaaaatcgaacgcaatggac
gtgagccaaccaaacaactggcctcgtatcgaagagctatgccgcgtgaaagaatggggc
ttggagacgctaggtaaaggtgcagtgtctgatgagcaaagcgctcagtcggtgaaagac
ctatacgcacttggctacctatgtgagccacacggtgcgattgcttaccgcgttcttgaa
gagcagctgcaagagggtgaaaccggtctgttcctatgtactgctcacccagcgaagttc
aaagaagtggtggatgatattctagaatccgacatcgaccttcctgcaccactagcgaag
cacgctgcgatggagctgctatcggaagatctcgacgctgactttgacgcattgaaacaa
gtactgcgccgcgtgcagtaa

DBGET integrated database retrieval system