KEGG   Vibrio campbellii: VIBHAR_00941Help
Entry
VIBHAR_00941      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vha  Vibrio campbellii
Pathway
vha00260  Glycine, serine and threonine metabolism
vha00750  Vitamin B6 metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01230  Biosynthesis of amino acids
Module
vha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBHAR_00941
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VIBHAR_00941
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VIBHAR_00941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABU69940
UniProt: A7MXM8
Position
I:945682..946962
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELPKFEDVDALLAEDFVSRSTKILSAL
IGDELAEEQVNALVDAAFQFPAPINQVKDDVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
DGDFDACQALVKQAFDDSALREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGQWAPKPTVATKSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYALGYLCEPHGAIAYRVLE
EQLQEGETGLFLCTAHPAKFKEVVDDILESDIDLPAPLAKHAAMELLSEDLDADFDALKQ
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaatataaaagaaaatgatgaacaagtttcctttggccaagccgttcgc
caaggattaggccgtaaccaaggtctatttttcccatcggaattaccaaaatttgaagat
gttgatgcgctgctggcagaagactttgtttctcgtagcacgaaaatcctatcagcactg
attggcgatgagttggcggaagagcaagttaacgcattggttgacgctgcattccaattc
ccagcaccaatcaaccaagtaaaagacgatgtttacgctctggagcttttccatggtcca
acgcttgcgtttaaagactttggtggtcgctttatggcgcaatctcttgcggcagtttcg
gacggtggcaagatcactatcctaacggcaacttctggcgatactggcgcagccgttgcg
cacgctttctatggtatggaagacatcaacgttgtgattctgtatccgaaaggcaaaatc
agcccattgcaagagaagctattctgtacgcttggtaagaacatccatactgtcgcgatc
gatggagacttcgatgcgtgtcaggctctggttaagcaagcttttgatgattctgcactg
cgtgaagagatcggtctcaactctgcaaactcaatcaacatcagccgtttgatggcgcaa
atctgttactactttgaagcagctgcgcaaatgagcaaacaagagcgtgaaaacctagtg
gtatcagtaccaagcggtaacttcggtaacctaactgctggcctactggcaaaagcactg
ggtctgcctattaagcgcttcatcgctgcaacgaatgccaatgacactgtgccacgttac
ctagaaacgggtcagtgggcgccgaaaccaacggttgcaacaaaatcgaacgcaatggac
gtgagccaaccaaacaactggcctcgtatcgaagagctatgccgcgtgaaagaatggggc
ttggagacgctaggtaaaggtgcagtgtctgatgagcaaagcgctcagtcggtgaaagac
ctatacgcacttggctacctatgtgagccacacggtgcgattgcttaccgcgttcttgaa
gagcagctgcaagagggtgaaaccggtctgttcctatgtactgctcacccagcgaagttc
aaagaagtggtggatgatattctagaatccgacatcgaccttcctgcaccactagcgaag
cacgctgcgatggagctgctatcggaagatctcgacgctgactttgacgcattgaaacaa
gtactgcgccgcgtgcagtaa

DBGET integrated database retrieval system