KEGG   Vibrio campbellii: VIBHAR_00957Help
Entry
VIBHAR_00957      CDS       T00589                                 

Definition
protein-disulfide isomeras
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VIBHAR_00957
Secretion system [BR:vha02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VIBHAR_00957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:962515..963333
Genome map
AA seq 272 aa AA seqDB search
MKGFNFKVNLMSVLRRLTLLTLPFFVTACGAEESQAKTETPAQQVAPAAKQNFDEAALKA
KFSKLGVSILDIQPSDVAGLLEIQTNGGVLFASNDGNHFIAGTLYAIDDNGGYKDVVAER
QAPLNAAKIAKFSDSVIEYKADNEKYVVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMA
YPRQGATGPVAEQMATIWCAEDPQSAMHNAKVERTFDNPAKDLKQCKETIQAHYNLGREL
GISGTPAIFLPNGELVGGYLPPADLLKRLEQQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatttaattttaaggtgaatttaatgagcgtattacgccgactaactctgctg
actttaccgtttttcgttaccgcttgtggtgctgaagaaagtcaggcaaaaacggaaact
cctgcacaacaagtcgcaccagcggcaaaacagaattttgatgaggctgcactaaaagcc
aagttctctaagttgggggtatctattcttgatattcaaccatcagacgttgctggttta
ttagaaattcaaaccaatggtggtgtgctgttcgcatcaaacgatggtaatcactttatt
gccggtacgctttacgccatcgatgataacggcggctacaaagacgtcgttgctgaacgc
caagcaccattgaatgcagcaaaaatcgcgaagttctctgacagcgtgatcgaatataaa
gcggacaacgagaagtatgtggtgacggtgtttacggatatcacatgtggttactgtgtg
cgtctgcatagccaaatgcaaggttacaacgacttaggcattactgttcgttacatggcg
taccctcgtcaaggcgcaacaggcccagtcgctgagcagatggcaactatttggtgtgca
gaggatcctcaatccgccatgcacaatgcaaaagtggaacgtacatttgataacccagcg
aaagatcttaagcagtgtaaagagactatccaagcgcattacaacctaggtcgtgagctt
ggtatttctggtacacctgcgatcttcctaccaaacggtgagctagtaggtggttacctt
ccgccagcagatctgctaaaacgtttagagcaacaataa

DBGET integrated database retrieval system