KEGG   Vibrio campbellii: VIBHAR_01041Help
Entry
VIBHAR_01041      CDS       T00589                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vha  Vibrio campbellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_01041
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_01041
   00630 Glyoxylate and dicarboxylate metabolism
    VIBHAR_01041
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VIBHAR_01041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1049896..1051530
Genome map
AA seq 544 aa AA seqDB search
MIMLAQTEQKTQQLKQTQGMLEVNGVVAPEHQAIFPVEAQTFLSLLCEKFAERVEQLLEA
REEKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNAN
VKVFMADFEDSMSPAWSKVLDGQINLRDAVNGTISYSNPGNGKHYQLAEDPAVLICRVRG
LHLKEKHVTWHGQIIPGALFDFALYFYNNYKALLKKGSGPYFYIPKLQSHHEAKWWSEVL
HFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKN
HPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRDAFAMGGMAAFIPAKDPQENQKVLDKI
HNDKSLEANNGHDGTWVAHPGLADTAMEVFSATLGQRTNQLDVSRSEDAPITAAELLEPY
EGERSEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLD
NGLKVTKELFELYLKEEIEVVEQEIGEQRYQAGRFEEAADLMARLITSDELTNFLTIPGY
DYLD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcttgctcagacagaacaaaaaacacaacaactaaagcaaacccaaggcatg
cttgaggtgaatggagtcgttgctcctgaacatcaagcaattttccctgttgaagcccaa
acctttttatctctactgtgtgaaaaatttgccgaacgtgttgaacagttgctggaagca
cgagaagagaagcaagcacgcatcgacgctggtgaactgccagactttctaccagagaca
caagacattcgtgaaggaagctggaagatccttggaatcccgcaagatctgcaagatcgc
cgagtggaaatcactggaccaaccgatcgcaagatggtgattaacgcactgaatgcgaat
gtaaaagtgttcatggccgatttcgaagattcgatgtcccctgcgtggagtaaagttctg
gatggtcaaatcaacctgcgcgacgctgttaatggcaccatcagctacagcaatcctggc
aatggcaagcactatcagctggcagaagacccagcggtgttgatctgccgtgttcgcgga
ctgcatctaaaagaaaaacacgtaacgtggcacggtcagatcattccaggtgcgctattc
gatttcgctctgtacttctacaacaactacaaagcgctactgaaaaagggaagcggtcct
tacttctacattccaaaactgcaatcgcatcatgaagctaagtggtggagcgaagtgctc
catttcaccgaagaatatttcggtttggatactggcaccatcaaagcgactgtactgatt
gaaaccttaccagccgtattcgaaatggatgagattctgttctctctgaaagagcacatc
gttggtttgaactgtggtcgctgggattacatctttagctacatcaaaacactgaaaaac
cacccagatcgcgtacttccggatcgccaagtggtgaccatggataagccattcctcaac
gcttactcaagattgttggtgcgaacttgtcataaacgtgacgcatttgcgatgggcggc
atggcagcctttattccggctaaagacccacaagaaaaccaaaaagtgctggataagatc
cacaacgataaatcactagaagccaacaacggtcatgacggcacttgggttgctcaccct
ggtttggcagacaccgcaatggaagtgttcagtgccacactggggcagcgcactaaccaa
ttggatgtgagccgctcagaagacgcaccaatcaccgccgcagagctgcttgaaccttac
gagggtgaacgctcagaagaaggtatgcgccacaacatccgcgttgcgctgcaatacatc
gaagcgtggatctctggcaatggttgtgtgccgatttacgggctgatggaagacgctgca
acggcagaaatctcccgtgcttctatttggcaatggattcaacacggtaagtcgctcgac
aacggattgaaggtcactaaagagctgttcgaactctatctgaaagaagagattgaagtc
gtggagcaagaaattggcgagcagcgttaccaagcaggtcgatttgaagaagcggcagat
ttgatggctaggctcatcacaagcgatgaactgaccaactttttaaccattccaggttac
gactacttggattaa

DBGET integrated database retrieval system