KEGG   Vibrio campbellii: VIBHAR_01041Help
Entry
VIBHAR_01041      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vha  Vibrio campbellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_01041
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_01041
   00630 Glyoxylate and dicarboxylate metabolism
    VIBHAR_01041
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VIBHAR_01041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
I:1049896..1051530
Genome map
AA seq 544 aa AA seqDB search
MIMLAQTEQKTQQLKQTQGMLEVNGVVAPEHQAIFPVEAQTFLSLLCEKFAERVEQLLEA
REEKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNAN
VKVFMADFEDSMSPAWSKVLDGQINLRDAVNGTISYSNPGNGKHYQLAEDPAVLICRVRG
LHLKEKHVTWHGQIIPGALFDFALYFYNNYKALLKKGSGPYFYIPKLQSHHEAKWWSEVL
HFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKN
HPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRDAFAMGGMAAFIPAKDPQENQKVLDKI
HNDKSLEANNGHDGTWVAHPGLADTAMEVFSATLGQRTNQLDVSRSEDAPITAAELLEPY
EGERSEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLD
NGLKVTKELFELYLKEEIEVVEQEIGEQRYQAGRFEEAADLMARLITSDELTNFLTIPGY
DYLD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcttgctcagacagaacaaaaaacacaacaactaaagcaaacccaaggcatg
cttgaggtgaatggagtcgttgctcctgaacatcaagcaattttccctgttgaagcccaa
acctttttatctctactgtgtgaaaaatttgccgaacgtgttgaacagttgctggaagca
cgagaagagaagcaagcacgcatcgacgctggtgaactgccagactttctaccagagaca
caagacattcgtgaaggaagctggaagatccttggaatcccgcaagatctgcaagatcgc
cgagtggaaatcactggaccaaccgatcgcaagatggtgattaacgcactgaatgcgaat
gtaaaagtgttcatggccgatttcgaagattcgatgtcccctgcgtggagtaaagttctg
gatggtcaaatcaacctgcgcgacgctgttaatggcaccatcagctacagcaatcctggc
aatggcaagcactatcagctggcagaagacccagcggtgttgatctgccgtgttcgcgga
ctgcatctaaaagaaaaacacgtaacgtggcacggtcagatcattccaggtgcgctattc
gatttcgctctgtacttctacaacaactacaaagcgctactgaaaaagggaagcggtcct
tacttctacattccaaaactgcaatcgcatcatgaagctaagtggtggagcgaagtgctc
catttcaccgaagaatatttcggtttggatactggcaccatcaaagcgactgtactgatt
gaaaccttaccagccgtattcgaaatggatgagattctgttctctctgaaagagcacatc
gttggtttgaactgtggtcgctgggattacatctttagctacatcaaaacactgaaaaac
cacccagatcgcgtacttccggatcgccaagtggtgaccatggataagccattcctcaac
gcttactcaagattgttggtgcgaacttgtcataaacgtgacgcatttgcgatgggcggc
atggcagcctttattccggctaaagacccacaagaaaaccaaaaagtgctggataagatc
cacaacgataaatcactagaagccaacaacggtcatgacggcacttgggttgctcaccct
ggtttggcagacaccgcaatggaagtgttcagtgccacactggggcagcgcactaaccaa
ttggatgtgagccgctcagaagacgcaccaatcaccgccgcagagctgcttgaaccttac
gagggtgaacgctcagaagaaggtatgcgccacaacatccgcgttgcgctgcaatacatc
gaagcgtggatctctggcaatggttgtgtgccgatttacgggctgatggaagacgctgca
acggcagaaatctcccgtgcttctatttggcaatggattcaacacggtaagtcgctcgac
aacggattgaaggtcactaaagagctgttcgaactctatctgaaagaagagattgaagtc
gtggagcaagaaattggcgagcagcgttaccaagcaggtcgatttgaagaagcggcagat
ttgatggctaggctcatcacaagcgatgaactgaccaactttttaaccattccaggttac
gactacttggattaa

DBGET integrated database retrieval system