KEGG   Vibrio harveyi: VIBHAR_01041Help
Entry
VIBHAR_01041      CDS       T00589                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vha  Vibrio harveyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vha01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vha00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vha00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1049896..1051530
Genome map
AA seq 544 aa AA seqDB search
MIMLAQTEQKTQQLKQTQGMLEVNGVVAPEHQAIFPVEAQTFLSLLCEKFAERVEQLLEA
REEKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNAN
VKVFMADFEDSMSPAWSKVLDGQINLRDAVNGTISYSNPGNGKHYQLAEDPAVLICRVRG
LHLKEKHVTWHGQIIPGALFDFALYFYNNYKALLKKGSGPYFYIPKLQSHHEAKWWSEVL
HFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKN
HPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRDAFAMGGMAAFIPAKDPQENQKVLDKI
HNDKSLEANNGHDGTWVAHPGLADTAMEVFSATLGQRTNQLDVSRSEDAPITAAELLEPY
EGERSEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLD
NGLKVTKELFELYLKEEIEVVEQEIGEQRYQAGRFEEAADLMARLITSDELTNFLTIPGY
DYLD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcttgctcagacagaacaaaaaacacaacaactaaagcaaacccaaggcatg
cttgaggtgaatggagtcgttgctcctgaacatcaagcaattttccctgttgaagcccaa
acctttttatctctactgtgtgaaaaatttgccgaacgtgttgaacagttgctggaagca
cgagaagagaagcaagcacgcatcgacgctggtgaactgccagactttctaccagagaca
caagacattcgtgaaggaagctggaagatccttggaatcccgcaagatctgcaagatcgc
cgagtggaaatcactggaccaaccgatcgcaagatggtgattaacgcactgaatgcgaat
gtaaaagtgttcatggccgatttcgaagattcgatgtcccctgcgtggagtaaagttctg
gatggtcaaatcaacctgcgcgacgctgttaatggcaccatcagctacagcaatcctggc
aatggcaagcactatcagctggcagaagacccagcggtgttgatctgccgtgttcgcgga
ctgcatctaaaagaaaaacacgtaacgtggcacggtcagatcattccaggtgcgctattc
gatttcgctctgtacttctacaacaactacaaagcgctactgaaaaagggaagcggtcct
tacttctacattccaaaactgcaatcgcatcatgaagctaagtggtggagcgaagtgctc
catttcaccgaagaatatttcggtttggatactggcaccatcaaagcgactgtactgatt
gaaaccttaccagccgtattcgaaatggatgagattctgttctctctgaaagagcacatc
gttggtttgaactgtggtcgctgggattacatctttagctacatcaaaacactgaaaaac
cacccagatcgcgtacttccggatcgccaagtggtgaccatggataagccattcctcaac
gcttactcaagattgttggtgcgaacttgtcataaacgtgacgcatttgcgatgggcggc
atggcagcctttattccggctaaagacccacaagaaaaccaaaaagtgctggataagatc
cacaacgataaatcactagaagccaacaacggtcatgacggcacttgggttgctcaccct
ggtttggcagacaccgcaatggaagtgttcagtgccacactggggcagcgcactaaccaa
ttggatgtgagccgctcagaagacgcaccaatcaccgccgcagagctgcttgaaccttac
gagggtgaacgctcagaagaaggtatgcgccacaacatccgcgttgcgctgcaatacatc
gaagcgtggatctctggcaatggttgtgtgccgatttacgggctgatggaagacgctgca
acggcagaaatctcccgtgcttctatttggcaatggattcaacacggtaagtcgctcgac
aacggattgaaggtcactaaagagctgttcgaactctatctgaaagaagagattgaagtc
gtggagcaagaaattggcgagcagcgttaccaagcaggtcgatttgaagaagcggcagat
ttgatggctaggctcatcacaagcgatgaactgaccaactttttaaccattccaggttac
gactacttggattaa

DBGET integrated database retrieval system