KEGG   Vibrio harveyi: VIBHAR_01042Help
Entry
VIBHAR_01042      CDS       T00589                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vha  Vibrio harveyi
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vha01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vha00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1051679..1052992
Genome map
AA seq 437 aa AA seqDB search
MTNLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLV
NGSSKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSV
PSVVKRINNSFRRADQIQWSAGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMID
AGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTTTLVIARTDANA
ADLLTSDCDPYDKDFIQGERTPEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEE
ARKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQELANMGYKYQFITLAGIHN
MWFNMFELAHAYAQGEGMRHYVEKVQRPEFEAAEKGYTFVAHQQEVGTGYFDRMTNTIQG
GNSSVTALTGSTEEDQF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgactaacttaactcgccgccaacaaattgaagctctggaaaaagattgggcaaccaac
ccacgctggaaaaatgtaaagcgtacttacacagcagaagaagtagtagaactgcgtggc
tctatggtacctgcgaacacaatcgcacaacgtggtgctgacaaactttggtcactggtc
aacggtagttcaaagaaaggctacgtaaactgtcttggtgcactaacgggtggtcaagcc
gtacagcaagcgaaagcgggtattgaagctatttacctatcaggttggcaggtagcagcg
gataacaacaccgcttcgacgatgtacccagaccaatccctgtacccagtagattcggta
ccgtcggtagtaaaacgcatcaacaactcattccgtcgtgcagaccaaattcagtggtca
gcaggtaagtcaccagaagatgaaggcggtattgattacttcctaccaatcgtagcggat
gcggaagcaggctttggtggggtattgaacgcttacgagctaatgaaatcgatgatcgac
gcaggtgcggcaggtgttcactttgaagaccaactggcatcagtgaagaagtgtggccac
atgggcggtaaagtactggttccaactcaagaagcggtgcaaaaactggtagcggctcgc
cttgcagcagacgttgcaggcacgacaacgctggtaattgcgcgtaccgatgcaaacgca
gcagacctactaacgtctgattgtgacccatacgataaagactttattcaaggagagcgt
acgccagagggcttctaccgtgtacgtgcaggtatcgaccaagctatctctcgtggccta
gcttacgcgccatatgcggatctaatctggtgtgagacagcaacgccatgtctagaagaa
gcacgcaagtttgcagaagcaattcatgcagagtacccagaccaactgttggcatacaac
tgctcgccttcattcaactgggagaagaacctagacgcagaaaccattgctaagttccaa
caagagctggctaacatgggctacaagtaccagttcattacgctagcaggtatccacaac
atgtggttcaacatgttcgaattggcacacgcttacgctcaaggcgaaggtatgcgtcat
tatgttgagaaggttcaacgtcctgagtttgaagcggcagaaaaaggttacacgttcgta
gcgcaccaacaagaagttggtacgggttacttcgatagaatgaccaacacaattcaaggc
ggtaactcgtcagtgacagcactgacaggttctactgaagaagaccaattctaa

DBGET integrated database retrieval system