KEGG   Vibrio harveyi: VIBHAR_01162Help
Entry
VIBHAR_01162      CDS       T00589                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vha  Vibrio harveyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vha01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vha00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1182163..1183302
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALNRAHMVELARQCAELKKQGHSVVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLDDR
ERFLNARDTINALVANDIIPIVNENDAVATNEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSSEPQGTRFLPCEEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNSHGKLVARGISAYSSEDLAKIAGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacagaatgcagttgtttcgcaaccacagaccgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcactttggcgttaaaccgtgctcatatggtagagctg
gctcgtcaatgtgctgagctaaaaaaacaaggccattcagtagtaatggtttcgtctggt
gcgattgcagcaggccgtgagcatcttggataccccgcactgcccaacgagatggcgagc
aaacagttgcttgctgctgtgggccagagccgtttgattcaaacatgggagtctttgttt
ggcatttatggcatcaaaattggtcagatgctgctaactcgtgcggatttggacgatcgc
gagcgtttcctaaatgcgcgtgacaccatcaatgctctggttgcaaacgacattattcct
atcgtgaacgaaaacgatgcggtagcaaccaacgagatcaaagttggtgacaacgataac
ttgtctgctttggtggggattttgtgtggtgcagacaaattactgctgctaacagaccaa
aaaggtttgtttactgcagaccctcgtaaagatccaaatgccgaactgatcaaagaagtg
aaaaccatcgatgatactttgcgtaagattgcgggtggtagcggcacaacgctaggtact
ggcggcatggcaaccaagcttcaggcggcagacatcgctcgacgtgcaggcattgaggtg
atcattgcagcgggtagtgcaccaaatgttatctttgactcattgagctcagagccacaa
ggcacgcgtttccttccttgtgaagaagcgctagaaaaccgtaaacgctggatcttagcg
ggccctgcggcatctggtgacatcattattgacgatggcgcagtgaatgcggttgttggc
aaaggtagcagcctgcttgcaaaaggcgttattaaggtaagcggtgactttgctcgtggc
gaagtggcgcgcgtaacaaactctcacggcaaactggttgctcgtggtatcagcgcctac
tcaagtgaagacctcgcgaaaatcgccggtaagcacagtaaagatatcatctctattttg
ggtcatgactacggctcagaagtgattcatcgcgatgatcttgtcgtcattcaagaatag

DBGET integrated database retrieval system