KEGG   Vibrio harveyi: VIBHAR_01265Help
Entry
VIBHAR_01265      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vha  Vibrio harveyi
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vha00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vha00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1273263..1275914
Genome map
AA seq 883 aa AA seqDB search
MLKHSLIAASVIATLAGCSSLQNSEQQVVNSLADNLDIQYEVLTNHGANEGLACQDMGAE
WASCNKVNMTLVNQGEAVDSKDWAIYFHSIRLILDVDNEQFKISRVTGDLHKLEPTDKFD
GFAAGEEVVLPLVAEYWQLFETDFMPGAFVAAPNAEPKMIASLNTEDVASFVTGLEGNNL
KRTPDDNNVFANAVSRFEKNEDLAKQDVSTTLLPTPMSVEAGKGTVDIAAGIALPKDAFD
ATQYAAIQDRAEVVGVDVRGDLPVSITVVPADFTGELAKSGAYEMSIKGDGIAIKAFDQA
GAFYAVQSIFGLVDSQNADSLPQLSIKDAPRFDYRGVMVDVARNFHSKDAILATLDQMAA
YKMNKLHLHLTDDEGWRLEIPGLPELTEVGANRCFDLEEKSCLLPQLGSGATTDNFGSGF
FSKADYVDILKYAKARNIEVIPEIDMPAHARAAVVSMEARYDRLMEEGKEAEANEYRLMD
PKDTSNVTTVQFYNKQSFINPCMESSTRFVDKVISEVAAMHQEAGAPLTTWHFGGDEAKN
IKLGAGFQDVNAEDKVSWKGTIDLSKQDKPFAQSPQCQTLIADGTVSDFAHLPSHFAEEV
SKIVAEKGIPNFQAWQDGLKYSEGEKAFATENTRVNFWDVLYWGGTSSVYEWSKKGYDVI
VSNPDYVYMDMPYEVDPKERGYYWATRATDTRKMFGFAPENMPQNAETSLDRDGNGFTGK
GEIEAKPFYGLSAQLWSETVRNDEQYEYMVFPRVLAAAERAWHRADWENDYKVGVEYSQN
SNLVDKAALNQDYNRFANVLGQRELAKLEKSGIDYRLPIPGAKVEDGKLAMNVQFPGVKL
QYSLDGKNWLTYADNARPNVKGEVFIRSVSATGEKTSRVTSVK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacatagtctgattgctgcttctgttattgctacattggcaggctgctcttca
ctgcagaactctgagcaacaagttgtaaactcattggctgacaaccttgatattcaatat
gaagtactaacaaaccacggtgctaacgaaggtcttgcatgtcaagacatgggcgcagag
tgggcgtcttgtaacaaggtaaacatgacgctagttaaccaaggtgaagcggttgactct
aaagattgggctatttacttccacagcattcgtctgattctggatgtagacaacgagcaa
ttcaaaatttctcgcgtaacgggtgacctacacaaactagaaccgaccgataagtttgat
ggttttgctgcgggtgaagaagttgtgcttcctcttgttgctgaatactggcagctattt
gaaactgacttcatgccaggcgctttcgttgctgcaccaaatgcagagcctaagatgatc
gcttctcttaacacagaagacgttgcatctttcgttactggccttgagggcaacaacctt
aaacgtacgccagatgacaacaacgtatttgcaaacgctgtgtctcgtttcgagaagaac
gaagacctagcaaaacaagacgtatcaaccacgttactaccaacgccaatgtctgttgaa
gcaggtaaaggtacagtagatatcgcggcgggtattgcgctgcctaaagacgcattcgat
gcgactcaatacgcagcaattcaagatcgtgcagaagtggtaggtgtggatgttcgtggt
gatcttcctgtaagcatcactgttgttcctgcagacttcaccggtgaattagcaaaatct
ggtgcttacgaaatgagcatcaaaggcgacggtattgcgattaaagcgtttgaccaagca
ggtgctttctacgcagtacaatctatctttggcctggtagatagccaaaatgctgattct
ctaccacaactgtctattaaagatgcgccgcgttttgattaccgtggtgtgatggtggac
gtggctcgtaacttccactctaaagacgcaattcttgcaacgcttgaccaaatggcagcg
tacaagatgaacaaactacaccttcacctaacggatgatgaaggctggcgtttagaaatc
ccgggtctgcctgagctgactgaagtgggtgctaaccgttgtttcgatttggaagagaaa
agctgtttactgcctcagcttggctcaggtgcaacgacagacaacttcggttctggcttc
ttcagcaaagcagactacgtggacatcttgaagtacgcgaaagcacgtaacattgaagtg
attccagaaattgatatgccagcgcacgctcgtgcagcggtagtatcaatggaagcgcgt
tacgaccgtctaatggaagaaggtaaagaagcagaagcgaacgaataccgcctgatggat
cctaaagatacatcgaatgtaacgacggttcagttctacaacaagcaaagcttcatcaac
ccatgtatggaatcttcaactcgctttgttgataaagtgatttcagaagtcgcagcaatg
caccaagaagcgggcgcaccgctaacaacatggcactttggtggtgacgaagcgaagaac
attaagctaggcgctggtttccaagatgtgaacgctgaagacaaagtaagctggaaaggt
acgattgacctgtctaaacaagataagccattcgcacagtctccacaatgtcagacgcta
attgcagacggtacggtaagcgactttgctcatctaccaagccacttcgcagaagaagtg
tcgaagattgtggccgagaaaggcattccaaacttccaagcttggcaagatggccttaag
tacagtgaaggtgagaaagcgttcgcaacagaaaacacacgtgttaacttctgggacgtt
ctttactggggcggcacatcatcagtgtacgagtggtctaagaaaggttacgacgtgatc
gtttctaacccagactacgtttacatggacatgccatacgaagtggatccgaaagagcgt
ggttactactgggcaacgcgtgcaacagatactcgtaagatgtttggctttgcaccagag
aacatgcctcagaacgcagaaacgtctctagatcgcgatggcaacggctttactggtaaa
ggtgaaatcgaagcgaaacctttctacggtctatcagcacagctttggtctgagacagta
cgtaacgacgagcaatacgagtacatggtattccctcgcgtactggcagccgctgagcgt
gcatggcaccgtgcagactgggaaaacgactacaaagtgggtgttgaatactcgcaaaac
tctaacctagtggacaaagctgcgctaaaccaagactacaaccgctttgcgaacgtactt
ggtcaacgtgaactggcgaagctagagaaatcaggcatcgactaccgcctacctatacca
ggtgcgaaagtagaagatggcaagctagcaatgaacgttcagttccctggtgtgaagctt
caatactctctagacggcaaaaactggctaacttacgcagacaatgctcgtccaaatgtg
aaaggtgaagtgtttatccgctcggtatctgcgacaggcgagaaaacaagtcgtgtgact
agcgtgaagtaa

DBGET integrated database retrieval system