KEGG   Vibrio campbellii: VIBHAR_01356Help
Entry
VIBHAR_01356      CDS       T00589                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vha  Vibrio campbellii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_01356
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VIBHAR_01356
  Amino acid metabolism
   00310 Lysine degradation
    VIBHAR_01356
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VIBHAR_01356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1367351..1368559
Genome map
AA seq 402 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKQPGDVVERDEVLVDIETDKVVLEVPAPEAGVLEAII
EEEGATVLSKQLIAKLKPGAVAGEPTTDSTEDKEASPDKRHKATLTEESNDALSPAVRRL
LAEHGLEASQVKGSGVGGRITREDIEAHLANAKAAPKAEAPAAVEAPAAARSQKRVPMTR
LRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQFEERHGTRLGFMSFYVKAVT
EALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDTLGFADIEKGIKELA
IKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQERPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatttacctgaatcagttgctgacgcaaccgtagcg
acatggcacaaacaaccaggcgacgtagtcgagcgtgatgaagttctggttgatatcgaa
accgataaagttgtgcttgaagtaccggctccggaagcgggcgttttagaagccattatt
gaagaagaaggtgcaacagtactttctaagcagttgatcgcgaagcttaagccaggcgca
gtagcaggcgaaccaacaacagattcaacagaagacaaagaagcgtctcctgataagcgt
cataaagcaacgctaacagaagagagcaacgatgcgctaagcccagcagttcgtcgtctt
cttgcagagcacggtctcgaagctagccaagtgaaaggctctggtgttggcggtcgtatt
actcgcgaagacattgaagcacatcttgcaaacgcaaaagcggcaccgaaagcagaagct
ccagcagccgttgaagcgcctgcagcggctcgtagccaaaagcgtgtaccaatgacgcgt
ctgcgtaagacagtagcaaaccgtcttctagaagcgaagaacaacacggcaatgctaacc
acgtttaacgaagtgaacatgaagccaatcatggaccttcgtaagcaatacaaagaccag
ttcgaagagcgtcacggtactcgtcttggcttcatgtctttctacgtgaaagcagtaact
gaagcactaaaacgttacccagaagtgaatgcctctatcgatggtgatgacattgtttac
cacaactacttcgacatcagcatggcggtttctacgccacgtggtctagtgacgccagtt
ctaaaagactgcgacacactaggttttgctgacatcgaaaaaggcatcaaagagctagca
attaaaggccgtgacggcaagctaacggttgatgagttgatgggcggtaatttcactatc
actaatggtggtgtatttggttcattgatgtctacgccaatcatcaacccaccacaatcg
gcaatcttgggcatgcacaaaatccaagagcgtccaatggcggttgacggcaaagtagaa
atcttgccaatgatgtacctagcactatcttacgaccaccgtttgatcgatggccgtgag
tcagtgggtttcctagtaaccattaaagagctactagaagatccagcgcgtctgctacta
gacgtttaa

DBGET integrated database retrieval system