KEGG   Vibrio harveyi: VIBHAR_01600Help
Entry
VIBHAR_01600      CDS       T00589                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vha  Vibrio harveyi
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1612246..1612917
Genome map
AA seq 223 aa AA seqDB search
MSIQFFIILSQIHFQRVFIVIGRLRGTLLEKQPPEVLIEVNGIGYEVQMPMSCFYELPNV
GEEAIIYTHFVVREDAQLLYGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVSC
VEREDISTLVKLPGVGKKTAERLVVEMKDRLKGWGAGDLFTPFTDAAPADSGSAASNNAE
EEAISALLALGYKPTQASKVVSQIAKPDMTSEQLIRKALKSMV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctatccagttctttattatcctgtcgcaaattcatttccaaagagtatttatagtg
attggacgtcttcgcggcactctgcttgaaaagcaaccacctgaagttttaattgaagtt
aatggcattggttatgaagttcagatgccaatgagctgtttctacgaactgccaaacgtc
ggtgaagaagccatcatttatactcactttgttgtgcgtgaagacgcgcaattgctttac
ggtttcaacacagtaaaagaacgtgcgcttttccgtgaagtgatcaaagcgaacggtgtt
ggtcctaagctaggtctgggtatcctctcaggcatgacggcaagccaattcgtttcttgt
gtagagcgtgaagacatttcaacgcttgtgaagctaccgggtgttggtaagaagacggct
gaacgcctcgtcgttgaaatgaaagaccgcttgaaagggtggggcgctggcgatctgttt
actccgtttactgatgcagcacctgcggactctggttctgcggcttctaacaacgcagaa
gaagaggcaatcagtgcgcttcttgctctaggctacaagccaactcaagcgtcgaaagtg
gtttctcagatcgctaaaccggatatgaccagtgagcaactgatccgtaaagcactaaaa
tcaatggtgtaa

DBGET integrated database retrieval system