KEGG   Vibrio harveyi: VIBHAR_01858Help
Entry
VIBHAR_01858      CDS       T00589                                 

Definition
alpha/beta hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vha  Vibrio harveyi
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vha00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vha00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1870782..1872521
Genome map
AA seq 579 aa AA seqDB search
MAQTIQLANHTEISVSDNDLQFEVVGNQIHFSFAGIHNKTFTDREVLFQMPFLYEQGATV
LGDGFQMLAQTSGTISQPIDIGRCPDNNNSYRIYPESAPKRYYNYLAVEDAAGYTLFGFT
SCHRFAGYFEVQTHGEHWVLSASIDGEHTQVADWEHNTLESVAILRGQSLSELYQQYSEM
IAKHHPVRDGVIQDAPIGWCSWYAYYADVTEDNVLENVECMQDNLAELEWVLLDDGYQAF
MGDWLTPSDKFSGGVKELIHNIRAKGKKPAIWMAPFIAQPESEIFKKHPDWFVRHEDGDL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTHVVSVMRQEWGVELFKLDANYWGTLKGKR
SQSGVTGVEAYRMGMEAIAKGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSHRFEQI
AKETFFRSWQHRKLWQIDPDCATFTSLPNQAASREDYQFHRNVLLACGGLLLSGDPLPEI
TPFASKTMAKLMLRQRRNQESAKFTALGLNHAFLPLTSKNDLHCLFNYANDEATEFTLTA
DQPTDWYDYWTGEKLNQEPCQLLLVSLDKGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccattcaattggccaatcacactgagatttcagtgagtgataacgatctt
caatttgaagtcgtaggcaaccaaatccatttttcttttgccgggatacacaataaaacc
ttcaccgatcgtgaagtcttgttccaaatgccttttctctatgagcaaggtgcaactgtg
cttggcgacggtttccaaatgttggcgcagacgagcggtaccatttctcaacctatcgat
attggtcgctgcccagataacaataattcctaccgtatttacccagagagtgcacctaag
cgttactacaactacttagctgtagaagatgccgcaggttacaccttgtttggctttacg
tcttgtcatcgctttgcaggctattttgaggttcagacgcacggtgagcattgggttctt
tctgcttctattgatggtgaacatacccaagtagcggattgggaacataacacactggaa
tctgtggccatattacgcggtcaatctctgtctgagctttaccaacaatacagtgagatg
attgcaaaacatcatcctgtgcgtgacggagtaatacaagacgctccgattggttggtgc
tcttggtatgcctactacgcggatgtgaccgaagacaacgttttagaaaacgtggaatgt
atgcaagacaacctagccgagctcgaatgggtgctgctagatgatggctaccaagcattt
atgggtgattggctaacgccttcggataagttctctggtggtgtgaaagagttgattcac
aacattcgcgcgaaaggcaaaaagccagcgatttggatggcaccattcattgcccagcca
gaatcagaaatcttcaaaaagcatcccgattggtttgtgcgtcacgaggacggagacctc
ctgaaagctgaagatgtcacttatggcggttggcgttgtacaccgtggtacattctcgat
acttcaaatcctgaagtgcaagatcatctaacccacgttgtgtccgtcatgcgtcaagag
tggggcgttgagttattcaaattagacgcaaactactggggcactttaaaaggtaagcgc
agtcaatcgggcgtaaccggtgtagaagcctaccgcatgggtatggaagcgatcgctaaa
ggggcgggagatgcgtggctgttaggttgtaacgcaccaatgtggccttctttggggctc
gttgatgccatgcgtgtttctgatgatgtagagcgccatagccatcgctttgaacaaatc
gcaaaagagaccttcttccgcagttggcagcatcgcaagttatggcaaattgacccagat
tgcgcgacattcacttcattacctaaccaagcagcctcgcgtgaagattatcaattccat
cgcaacgtgctgctagcgtgtggcggtctacttctttccggtgaccctctaccagaaatc
accccatttgcgagcaagacgatggcaaaactgatgctgcgccaacgccgtaatcaagaa
tcggctaagtttaccgcgctaggtttaaaccatgcgttcctaccactaacatctaaaaac
gatctgcactgtttgttcaactacgcgaacgatgaagcgacagagtttacgcttaccgca
gaccagccaacagattggtatgattactggaccggagagaagcttaaccaagagccttgt
cagctattactggtcagtttggataaaggtctgaatgctaaagctatcgtgaccgcatag

DBGET integrated database retrieval system