KEGG   Vibrio campbellii: VIBHAR_01858Help
Entry
VIBHAR_01858      CDS       T00589                                 

Definition
alpha/beta hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vha  Vibrio campbellii
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VIBHAR_01858
  Lipid metabolism
   00561 Glycerolipid metabolism
    VIBHAR_01858
   00600 Sphingolipid metabolism
    VIBHAR_01858
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VIBHAR_01858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1870782..1872521
Genome map
AA seq 579 aa AA seqDB search
MAQTIQLANHTEISVSDNDLQFEVVGNQIHFSFAGIHNKTFTDREVLFQMPFLYEQGATV
LGDGFQMLAQTSGTISQPIDIGRCPDNNNSYRIYPESAPKRYYNYLAVEDAAGYTLFGFT
SCHRFAGYFEVQTHGEHWVLSASIDGEHTQVADWEHNTLESVAILRGQSLSELYQQYSEM
IAKHHPVRDGVIQDAPIGWCSWYAYYADVTEDNVLENVECMQDNLAELEWVLLDDGYQAF
MGDWLTPSDKFSGGVKELIHNIRAKGKKPAIWMAPFIAQPESEIFKKHPDWFVRHEDGDL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTHVVSVMRQEWGVELFKLDANYWGTLKGKR
SQSGVTGVEAYRMGMEAIAKGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSHRFEQI
AKETFFRSWQHRKLWQIDPDCATFTSLPNQAASREDYQFHRNVLLACGGLLLSGDPLPEI
TPFASKTMAKLMLRQRRNQESAKFTALGLNHAFLPLTSKNDLHCLFNYANDEATEFTLTA
DQPTDWYDYWTGEKLNQEPCQLLLVSLDKGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccattcaattggccaatcacactgagatttcagtgagtgataacgatctt
caatttgaagtcgtaggcaaccaaatccatttttcttttgccgggatacacaataaaacc
ttcaccgatcgtgaagtcttgttccaaatgccttttctctatgagcaaggtgcaactgtg
cttggcgacggtttccaaatgttggcgcagacgagcggtaccatttctcaacctatcgat
attggtcgctgcccagataacaataattcctaccgtatttacccagagagtgcacctaag
cgttactacaactacttagctgtagaagatgccgcaggttacaccttgtttggctttacg
tcttgtcatcgctttgcaggctattttgaggttcagacgcacggtgagcattgggttctt
tctgcttctattgatggtgaacatacccaagtagcggattgggaacataacacactggaa
tctgtggccatattacgcggtcaatctctgtctgagctttaccaacaatacagtgagatg
attgcaaaacatcatcctgtgcgtgacggagtaatacaagacgctccgattggttggtgc
tcttggtatgcctactacgcggatgtgaccgaagacaacgttttagaaaacgtggaatgt
atgcaagacaacctagccgagctcgaatgggtgctgctagatgatggctaccaagcattt
atgggtgattggctaacgccttcggataagttctctggtggtgtgaaagagttgattcac
aacattcgcgcgaaaggcaaaaagccagcgatttggatggcaccattcattgcccagcca
gaatcagaaatcttcaaaaagcatcccgattggtttgtgcgtcacgaggacggagacctc
ctgaaagctgaagatgtcacttatggcggttggcgttgtacaccgtggtacattctcgat
acttcaaatcctgaagtgcaagatcatctaacccacgttgtgtccgtcatgcgtcaagag
tggggcgttgagttattcaaattagacgcaaactactggggcactttaaaaggtaagcgc
agtcaatcgggcgtaaccggtgtagaagcctaccgcatgggtatggaagcgatcgctaaa
ggggcgggagatgcgtggctgttaggttgtaacgcaccaatgtggccttctttggggctc
gttgatgccatgcgtgtttctgatgatgtagagcgccatagccatcgctttgaacaaatc
gcaaaagagaccttcttccgcagttggcagcatcgcaagttatggcaaattgacccagat
tgcgcgacattcacttcattacctaaccaagcagcctcgcgtgaagattatcaattccat
cgcaacgtgctgctagcgtgtggcggtctacttctttccggtgaccctctaccagaaatc
accccatttgcgagcaagacgatggcaaaactgatgctgcgccaacgccgtaatcaagaa
tcggctaagtttaccgcgctaggtttaaaccatgcgttcctaccactaacatctaaaaac
gatctgcactgtttgttcaactacgcgaacgatgaagcgacagagtttacgcttaccgca
gaccagccaacagattggtatgattactggaccggagagaagcttaaccaagagccttgt
cagctattactggtcagtttggataaaggtctgaatgctaaagctatcgtgaccgcatag

DBGET integrated database retrieval system