KEGG   Vibrio campbellii: VIBHAR_01975Help
Entry
VIBHAR_01975      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     VIBHAR_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1973689..1974168
Genome map
AA seq 159 aa AA seqDB search
MKHLNSAVKMLAAAGASALIMATAMIKPMEGVQYTPYTDVAGVQTVCYGHTGTDIISDKV
YSQAECDELLESDLAAVKRMVDPMIHVDIPETTRAALYSFTFNVGIGSFSRSTLLKLLNK
GEWYAACDQLKRWVYAAGKPWKGLMNRRDIERQVCLMQS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccttaattctgccgtcaagatgttagcagccgcaggggcttcggctcttatt
atggcgacagcaatgataaagccaatggaaggtgttcagtatactccttacaccgatgtc
gctggcgttcaaactgtttgttacggacatacaggaacagacatcatctcggacaaagtc
tactcacaagccgagtgtgatgaattgctcgagtccgacttggctgctgttaagcgaatg
gtcgacccgatgattcacgttgatatccctgagacgacacgagctgctctctactcattc
acgtttaacgttggcataggctcattttcacgctcgacgttactaaagctacttaacaaa
ggtgaatggtatgcagcatgtgaccagcttaaacgatgggtatacgcagcaggcaaacct
tggaaaggattgatgaaccgacgagatatagagaggcaagtatgcctaatgcaaagctga

DBGET integrated database retrieval system