KEGG   Vibrio harveyi: VIBHAR_02038Help
Entry
VIBHAR_02038      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vha  Vibrio harveyi
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vha00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vha00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vha02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2030838..2032511
Genome map
AA seq 557 aa AA seqDB search
MSLSRRDFIKVLSSGAVATTLTACGSDDTNTVTDASFEHGVASGDPTQTQVIIWTRVTTE
ASYVDVSWQVSATEDFSSIEQSGTFATDTSRDFTVKVDVQNLNPNTQYYYRFMVGEASSI
VGITQTLPEGSVDKASMAVVSCANYPAGYFNVYKEILEQHQKASFDVVLHLGDYIYEYGA
GGYASEDAAALGREPSKGTECITLDDYRKRYAQYRQDEDLQALHAALPMIAIWDDHELAN
DAWKEGAENHHNSEGSFNDRRAAAAAAWTEWLPVRENTFSNMLIYRQFAFGDLINLMMLD
TRLVGRDQPLDYFSLDAPTMEAIGGLVAQSRSTERELLGTEQLAWLMNAFNQEAKWNVLG
QQVLMSRMELPSSVMLAMFQLFTATDEQKMDALLAVNNAIASYLADPSSDTVKLPYNLDA
WDGYYVERERVYEIAKASSGNFVCLAGDTHNAWTSELKDVSNNPVGVEFATSSVSSPGLE
EYLALEPVAIAQMEYTLPNLVSELQWTDIKQRGFMRVTFTPEKAESTWYMLSTIKDRNYQ
VTKKVASTSDGLTLDIE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtctcgccgagattttataaaagtcctctcttcaggagccgttgctaccaca
ctaactgcatgtgggagtgatgatacaaatacagtcaccgatgcctcattcgaacatggt
gtcgccagtggtgacccaactcaaactcaagtaatcatctggacacgagtgactacggag
gcgagttatgtcgatgtctcttggcaggtgtctgcaacggaagatttctctagtattgag
caaagcggcacctttgcgacagataccagtcgtgatttcacggtgaaggtagatgtgcaa
aatctcaaccccaatacacagtattactaccgttttatggtcggtgaggcgagcagtatt
gtaggcataacgcagactctaccagaaggcagtgtagacaaagcatcgatggccgttgtg
tcttgtgcgaattatccggcgggttacttcaatgtctataaagagattttggaacagcac
caaaaagcgtcgttcgatgtggttttgcaccttggcgattacatctacgaatatggtgct
gggggttatgcgagtgaggatgcggcagcattggggcgtgagccaagcaagggcaccgaa
tgtattacgttagatgactaccgaaagcgctacgctcaatatcgccaagatgaagatctc
caagctctgcatgcagcattaccgatgatcgcaatctgggatgaccacgagttagcaaac
gatgcatggaaagagggggcggaaaaccaccataacagcgaaggcagttttaatgacaga
cgcgccgcggcggcagcggcttggactgagtggcttcctgtgcgagaaaataccttttca
aatatgctgatttatcgtcagtttgcctttggtgatttgatcaacttgatgatgctcgat
actcgattggtaggccgtgaccagccattggattatttttctctcgatgctccaactatg
gaggcgattggcggattagttgctcagtctcgcagtacagaacgagaactacttggtaca
gagcaactcgcttggttaatgaatgcgtttaatcaagaagcaaagtggaatgtgcttggg
cagcaggttcttatgtcgagaatggagctacctagctcggtgatgttggcgatgttccaa
ctctttacggcgacggatgagcagaaaatggacgcgctgctagcagtgaataatgcgatc
gccagttatcttgctgatccaagttcggacactgtaaagttgccatacaacctagacgct
tgggatggctattatgtggagcgtgagcgtgtttatgaaatcgctaaagcaagctcaggc
aattttgtttgcttagctggtgatacgcacaatgcttggaccagtgaactgaaggatgtg
tcaaacaaccctgttggtgtcgagttcgcgacaagttcggtcagctctccgggcctggaa
gaatatttagcgttggagcctgtcgccattgctcaaatggaatatacattgccgaatcta
gtttctgaactgcaatggacagacatcaagcaacgtggctttatgcgtgtcacctttaca
ccagagaaagcagagtcaacgtggtatatgttgtctacgattaaagatagaaactatcaa
gtaaccaaaaaagtggcatccacatcggatggcttgacgcttgatatagagtag

DBGET integrated database retrieval system