KEGG   Vibrio campbellii: VIBHAR_02762Help
Entry
VIBHAR_02762      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vha  Vibrio campbellii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VIBHAR_02762
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBHAR_02762
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VIBHAR_02762
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VIBHAR_02762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
I:2785087..2786277
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPEFRSEFMTLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
EDAHYLLGTAAGPHPFPTIVRDFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDPNGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDNVTDDEALEAFQEIARHEGIIPALESSHAVAHALRM
ARENPEKEQLLVVNLSGRGDKDIFTVHAILEEKGAI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgaatgcctactttggcgaatacggcggtcagtacgttccgcaaattcta
gttccggcactggagcaactagagcaagcgtttatcgacgcgcaagaagaccctgaattc
cgcagcgaattcatgacgcttctgcaagagtatgcgggccgcccaacggctttaactcta
actcgtaacctaactaaaggtacgaaaaccaaactgtacctaaaacgtgaagacttgctt
cacggtggtgcccacaagactaaccaagtgttggggcaagcgctacttgcgaaacgcatg
ggcaaaaacgaaatcatcgctgaaactggcgcaggtcaacacggtgttgcaaccgcacta
gcatgtgcgctgcttggccttaagtgtcgtgtttacatgggtgcaaaagacgttgagcgt
caaagcccgaacgtattccgtatgaaactcatgggtgcagaagttattcctgtccactct
ggttcagcaacacttaaagacgcatgtaacgaagcattacgcgactggtctgcaacttat
gaagacgcgcactacctattaggcacagcggcaggtcctcacccattcccaaccatcgtg
cgcgatttccaacgcatgattggtgaagaaacgaagaatcagattttggcacgtgaaggt
cgtcttcctgacgccgttatcgcgtgtgtgggcggtggttcaaacgctatcggcatgttt
gctgacttcatcgaagaagaaagtgttcgcctaattggtgttgagccagcaggtaaaggt
atcgataccgaccaacacggcgcgccacttaaacatggtaaaacgggtatcttctttggt
atgaaagcgccactgatgcaagatccaaacggtcaggttgaagaatcatactctgtttct
gctggtcttgatttcccttcagttggtccacagcacgcacacctgaacgcaatcggccgc
gctgaatacgacaacgtaacggatgacgaagcgctagaggcgttccaagaaattgcgcgt
cacgaaggcatcatcccagctctagagtcctctcacgctgtagcacatgcactgcgtatg
gctcgtgagaatccagaaaaagaacaattgttagttgtgaacctatcaggtcgtggtgat
aaagatatcttcactgtacatgccatcctagaagaaaaaggagcgatctaa

DBGET integrated database retrieval system