KEGG   Vibrio campbellii: VIBHAR_02763Help
Entry
VIBHAR_02763      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vha  Vibrio campbellii
Pathway
vha00260  Glycine, serine and threonine metabolism
vha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01130  Biosynthesis of antibiotics
vha01230  Biosynthesis of amino acids
Module
vha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBHAR_02763
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VIBHAR_02763
Enzymes [BR:vha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VIBHAR_02763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABU71717
UniProt: A7MRY1
Position
I:2786277..2787083
Genome map
AA seq 268 aa AA seqDB search
MSRYAKMFERLNEKNQGAFVPFVTACDPNAEQSYKIMETLVESGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFEQIGKIRAKYPELPIGLLMYANLVYSRGIENFYERCAK
AGIDSVLIADVPTNESSEFVAAAEKFGIHPIFIAPPTASDETLKHVSELGGGYTYLLSRA
GVTGAETKANMPVDHMLDKLNQFNAPPALLGFGISEPAQVKQALESGAAGAISGSAVVKI
IEANIEQPQFMLDKLGEFVSAMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttatgcaaagatgtttgagcgcctaaacgagaaaaaccaaggtgcgtttgta
ccgttcgtaacggcttgcgatccaaacgcagagcagtcttacaagatcatggaaacattg
gttgagtcgggcgctgatgctttagaactcggtattccattctcagatcctcttgcggat
ggcccgactatccaaggtgcgaacattcgtgctctagattctggtgctacacctgatatc
tgtttcgagcagattggtaagatccgagcgaaatacccagagttacctattggtcttctg
atgtacgcgaaccttgtgtactcacgtggtatcgaaaacttctacgagcgttgtgcaaaa
gcgggcatcgattctgttttgatcgcagacgtaccaaccaacgagagctcagaatttgtt
gcagcagcagagaagtttggaattcacccaatcttcattgccccaccaacggcaagtgat
gaaacgctgaagcacgtatccgaactcggtggcggctacacttacctactttctcgtgca
ggtgttactggcgctgagaccaaggcaaacatgcctgttgaccacatgttagataaactg
aatcaattcaatgcaccaccagcgctgcttggttttggtatttcagagccagcacaagta
aaacaagctctagaatctggtgcagcaggtgcgatttctggttctgccgtggtaaaaatt
atcgaagcgaacatcgagcaaccacaattcatgctcgataagctaggtgaattcgtttct
gcaatgaaagctgcaacacaaaaataa

DBGET integrated database retrieval system