KEGG   Vibrio harveyi: VIBHAR_03183Help
Entry
VIBHAR_03183      CDS       T00589                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vha  Vibrio harveyi
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vha01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vha00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3210903..3212039
Genome map
AA seq 378 aa AA seqDB search
MTDSPVLALAKDLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFEDTTNFWARRGTEA
PLFAFAGHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAEN
PDHKGSIGFLITSDEEGPFINGTVRVVETLMDRGENIDMCIVGEPSSTEVVGDVVKNGRR
GSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVSA
GTGASNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDKHELDYDLKWTFNGDPFLTDTG
ALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD
LEKLTDMYENTLKHLLAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagtccagtactggcactcgctaaagacctgatcagccgccagtccgtaacg
cctgaagatgcaggctgtcaggatgtaatgatcgagcgattaaaagcgcttggttttgaa
atcgaagtgatggtgtttgaggacaccactaacttctgggctcgccgtggtacagaagca
ccattgtttgcttttgccggtcacaccgatgtcgtaccagcaggcaagctagaacaatgg
gacacccacccatttgagccgactattatcgatggttaccttcacggtcgtggcgccgca
gacatgaaaggctcgctagcgtgtatggtcgtggcggttgagcgctttattgcagaaaac
ccagaccacaaaggctcgatcggcttcttgatcacgtcagacgaagaaggcccgttcatc
aacggtacggttcgcgtggttgaaacgctaatggatcgcggcgagaacatcgatatgtgt
atcgttggcgaaccttcaagtactgaagtggttggtgatgtcgtgaagaatggccgccgt
ggctcaatcaccggcgatctaactgtgaaaggtacgcaaggccacgtggcctaccctcac
ctagcgaacaacccagttcatcagtcacttatggctatccatgaacttgccaccacagag
tgggaccaaggtaacgactacttccctccgactagcttccagatcccgaatgtttcggca
ggtactggcgcgtctaacgtgattccgggtgagtttaacgttcaatttaaccttcgtttc
agtactgaattgagcaatgaagtgattgttcaacgcatcactgagactctggataaacac
gagctagactacgatctaaagtggacattcaatggcgacccgttcctaaccgatacaggt
gcgctacttgatgccgtcgttgcggcggttgatgaggtgaacagcactaagcctgcactt
ctgaccacaggtggtacgtctgatggccgcttcatcgcacgcatgggcggccaagtggtt
gagcttggtccagtgaacgcgacgattcataaagtgaacgagtgtgtaaaagtcgatgac
ctagagaaattgaccgacatgtacgagaacacgctaaagcacttattggcaaaatag

DBGET integrated database retrieval system