KEGG   Vibrio campbellii: VIBHAR_03183Help
Entry
VIBHAR_03183      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vha  Vibrio campbellii
Pathway
vha00300  Lysine biosynthesis
vha01100  Metabolic pathways
vha01120  Microbial metabolism in diverse environments
vha01230  Biosynthesis of amino acids
Module
vha_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VIBHAR_03183
Enzymes [BR:vha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VIBHAR_03183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABU72132
UniProt: A7MY37
Position
I:3210903..3212039
Genome map
AA seq 378 aa AA seqDB search
MTDSPVLALAKDLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFEDTTNFWARRGTEA
PLFAFAGHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAEN
PDHKGSIGFLITSDEEGPFINGTVRVVETLMDRGENIDMCIVGEPSSTEVVGDVVKNGRR
GSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVSA
GTGASNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDKHELDYDLKWTFNGDPFLTDTG
ALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD
LEKLTDMYENTLKHLLAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagtccagtactggcactcgctaaagacctgatcagccgccagtccgtaacg
cctgaagatgcaggctgtcaggatgtaatgatcgagcgattaaaagcgcttggttttgaa
atcgaagtgatggtgtttgaggacaccactaacttctgggctcgccgtggtacagaagca
ccattgtttgcttttgccggtcacaccgatgtcgtaccagcaggcaagctagaacaatgg
gacacccacccatttgagccgactattatcgatggttaccttcacggtcgtggcgccgca
gacatgaaaggctcgctagcgtgtatggtcgtggcggttgagcgctttattgcagaaaac
ccagaccacaaaggctcgatcggcttcttgatcacgtcagacgaagaaggcccgttcatc
aacggtacggttcgcgtggttgaaacgctaatggatcgcggcgagaacatcgatatgtgt
atcgttggcgaaccttcaagtactgaagtggttggtgatgtcgtgaagaatggccgccgt
ggctcaatcaccggcgatctaactgtgaaaggtacgcaaggccacgtggcctaccctcac
ctagcgaacaacccagttcatcagtcacttatggctatccatgaacttgccaccacagag
tgggaccaaggtaacgactacttccctccgactagcttccagatcccgaatgtttcggca
ggtactggcgcgtctaacgtgattccgggtgagtttaacgttcaatttaaccttcgtttc
agtactgaattgagcaatgaagtgattgttcaacgcatcactgagactctggataaacac
gagctagactacgatctaaagtggacattcaatggcgacccgttcctaaccgatacaggt
gcgctacttgatgccgtcgttgcggcggttgatgaggtgaacagcactaagcctgcactt
ctgaccacaggtggtacgtctgatggccgcttcatcgcacgcatgggcggccaagtggtt
gagcttggtccagtgaacgcgacgattcataaagtgaacgagtgtgtaaaagtcgatgac
ctagagaaattgaccgacatgtacgagaacacgctaaagcacttattggcaaaatag

DBGET integrated database retrieval system