KEGG   Vibrio campbellii: VIBHAR_03300Help
Entry
VIBHAR_03300      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vha  Vibrio campbellii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VIBHAR_03300
Enzymes [BR:vha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VIBHAR_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3322370..3324547)
Genome map
AA seq 725 aa AA seqDB search
MKTNDLLSEQSSPVATRDLAATPDLLATLESLANKGAIRQLDFQFARFIYSQVEQQENSQ
ELAFIAGVVSSELGKGHICLLLFDGQGQPVDLASKLGLFGESALALNTQLQGVNWVELLQ
ASPLVGAQGEALPMMFDGERLYLHRYWHYEVTLADKLNQLSAAVNLQPQDFTRLSELLNH
LFARQYHFLFNALAKVVEAGTSNQVLPQQLVCDHLDVVTVDSLDWAAIDTAVNQAKQVHD
LQVLDKLVPLSACVNWQKVAAAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGQEKN
LTIKLVAPTGKAAARLTESIGKAIQELPVEPELKAKIPTESSTLHRLLGAIPNSAEFRHN
KQNPLHLDILVVDEASMVDLPMMYKVVDSLPKHARLILLGDKDQLASVEAGAVLGDICSF
HAFGFGKEQASAVAKLTGFDTLAYSTNSNASIADSLCMLQKSYRFDARSGIGQLAKAVNA
GSAAKVDDVWSRDFADIEHFALSSQNYNQMMQTLVAEYGRYLKRIGQQEIDQKTGEPETL
THKAKAVLDTFNQCRLLCAIREGDFGVTGLNQRIEKALAARKLIQTQDELWYHGRPVMVT
RNDHGLGLYNGDIGICMRDDSEGEPRLKVFFELPDGSVKSVLPSRVPEHETAYAMTIHKS
QGSEFEYTLMILPPDFSPILTRELIYTGITRAKKRLAMYAEMNVLKRGIKVKTTRASGLV
ERVRN
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaatgatcttctttctgagcaaagcagccctgtggcaacacgagatctagcg
gcaacgccagatctattggcaacgttagaatcgctagcaaataaaggggcgattcgccaa
ttggatttccagttcgcgcgctttatctattcgcaagttgagcaacaagagaacagccaa
gaactggcatttattgctggtgtggtcagcagtgaattaggcaaaggacacatctgtttg
cttctgtttgatggccaagggcaaccagtagatcttgccagtaagctcggtctttttggg
gagtctgcgttagcgcttaatactcaactgcagggcgtcaattgggtggagcttctgcaa
gcgtcgcctttggttggtgctcaaggtgaagccttgccaatgatgtttgatggtgagcgt
ctctacttgcatcgttactggcactatgaagtgacgttggcggacaagctcaatcaactc
agtgcagctgtaaaccttcagcctcaagattttacacgtttgtctgagttgcttaaccat
ttattcgctcgtcagtaccactttctgttcaatgcattagccaaagtggtagaggcagga
accagcaaccaagtgttacctcagcagctagtctgtgaccatttggatgtggttaccgta
gacagcctcgattgggcggccattgatacggcagtcaaccaagcgaaacaagttcacgat
ctacaagtgctggacaagcttgtaccattatcggcttgtgttaactggcagaaggtcgcg
gcagcggtagcactgacgcgtcgttttgcggtgatttccggtggtccgggtacgggtaaa
actactacggtaaccaaactgcttgccgcattgattgagcaagcaggacaagagaaaaac
ctcaccatcaagctggtggcgccaacaggtaaagccgcagcacgtttgacggagtctatt
ggtaaagcgattcaagagttgccagtggagcctgagcttaaagcgaaaattccaaccgag
tcgagcactttgcatcgcctgttgggcgcgatcccgaacagtgcagagtttcgtcacaat
aagcaaaatccgctgcacctcgatattttagtagtggatgaagcctctatggtcgatctg
ccgatgatgtacaaagtcgtcgattcgctaccaaagcatgcgcgtttgattctactggga
gataaagaccagttggcatcggtagaagctggtgcggtgctaggtgatatctgttcgttc
catgcatttggctttggcaaagagcaggcgtctgcggtcgcgaagttgacaggctttgac
actttggcgtacagcaccaatagtaatgcttcgattgccgatagcttatgtatgctgcaa
aagagttaccgattcgatgctcgctctggtatcggccagctagcaaaagcggtcaacgct
ggctcagctgcaaaagtagacgacgtttggagtcgtgattttgctgatatcgagcatttc
gcactgagtagtcaaaattacaatcagatgatgcagactttggttgccgaatatggtcgt
tatttaaaacgcatcggacagcaagagattgaccagaagactggggaaccagaaacgctg
acccacaaagccaaagctgtgctggatacttttaatcaatgccgcttgttgtgtgctatt
cgtgaaggtgattttggtgtgacaggtttaaaccaacgtattgaaaaagcactagcagca
cgtaagctaattcaaacccaagatgaactttggtatcacggcaggccagtgatggtcacg
cgtaacgatcatggcttgggattgtataacggtgatatcggcatttgcatgcgagatgac
agcgaaggcgaaccgcgtctcaaagtgttcttcgaactgccagacggcagcgtgaagtcg
gtgctgccaagccgagtccctgagcatgaaaccgcatatgcgatgaccattcataaatca
cagggcagtgagtttgaatacacgctaatgattttgccgccagatttcagtccaatcctc
actcgcgagctgatctacacaggtattactcgtgcaaagaaacgccttgcgatgtacgcc
gagatgaatgttctcaagcgtggtattaaagtaaaaactactcgagcgagtgggttggtt
gagcgagttagaaattga

DBGET integrated database retrieval system