KEGG   Vibrio campbellii: VIBHAR_03313Help
Entry
VIBHAR_03313      CDS       T00589                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vha  Vibrio campbellii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VIBHAR_03313 (glpK)
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VIBHAR_03313 (glpK)
Exosome [BR:vha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VIBHAR_03313 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3344830..3346347
Genome map
AA seq 505 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVILDHDANIVSVAQREFTQIYPEAGWVEHDPMEIWATQSST
LVEALAKTGIRSDQLAGIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADICEELKARG
LEDYVRDNTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINDLCWDQKMLDEMGIPASMMPEVKRSSEIYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKVTSKNGLLTTLACGPKGEPA
YALEGAVFMGGASIQWLRDEMKILAGAEDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLANLRVDGGAVANNFLM
QFQSDVLNTEVHRPQVTEVTALGAAYLAGLAVGFWNSIDELQDKAVLDRTFEPHDDEEKR
NRRYKGWKRAVKCAQTWSELHDEDD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacattgttgccctagaccaaggcacgacaagctctcgtgctgtc
attctggatcatgacgcgaatatcgtaagcgtcgctcagcgagaatttactcagatttat
ccagaggctggttgggttgaacatgacccaatggaaatctgggcaactcaaagctctact
ttggttgaagcacttgcgaaaaccggtatccgtagcgaccaacttgcaggtatcggtatt
accaaccaacgtgaaacgacgattgtatggaacaaagaaacaggcaaaccggtttacaac
gcaattgtatggcaatgccgccgtactgctgatatttgtgaagaattaaaagcgcgcgga
ctagaagattacgttcgcgacaatacaggtctggtgctagacccttacttctcaggtaca
aaagtgaagtggattctagataacgttgaaggcgcacgtgaagatgctgaagcaggcaaa
ctgctgttcggtaccgttgatacttggctggtttggaagatgacacaaggtcgcgttcac
gtaacggattacactaacgcatctcgtaccatgctgttcaacatcaacgacctatgctgg
gatcagaaaatgctggatgagatgggcattcctgcatccatgatgcctgaagttaaacgc
tcatcagaaatctacggccaaaccaacattggtggtaaaggcggtactcgtatcccaatc
gcgggtattgcaggtgaccaacaagctgcgctttacggtcagatgtgtgttgaagctggc
caagcgaagaacacctacggtacaggttgtttcttgttgatgaacacgggtcaagaaaaa
gtcacatcgaaaaatggcctgctgactaccctagcatgcggtccaaaaggcgagcctgct
tacgctcttgaaggtgcggtattcatgggtggcgcgtccattcaatggctacgtgatgaa
atgaagatcctggctggcgctgaagattcagaatactttgcgaccaaagtagatacttca
aatggcgtttacgttgtacctgcatttactggtctgggcgcaccatattgggacgcttac
gctcgcggtacgattgtcggtctaactcgtggcgtaaactctaaccacattatccgtgca
actttggaaggcatcgcttaccaaactcgtgatgtgctagatgcaatgcaagcagactcg
ggcatcaagctcgcgaaccttcgtgtagatggcggcgcagtagcgaacaacttccttatg
cagttccaatctgatgttcttaataccgaagttcaccgtcctcaagtaactgaagtaacc
gctttgggtgcagcctacctagccggtctagcggtgggtttctggaatagtattgatgaa
ctgcaagacaaagcagtgctcgatcgcacattcgaaccacatgatgatgaagagaaacgc
aaccgtcgctacaaaggttggaagcgcgcagttaagtgtgctcaaacctggtctgagctt
cacgacgaagacgattaa

DBGET integrated database retrieval system