KEGG   Vibrio campbellii: VIBHAR_03326Help
Entry
VIBHAR_03326      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vha  Vibrio campbellii
Pathway
vha00010  Glycolysis / Gluconeogenesis
vha00052  Galactose metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
Module
vha_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_03326
   00052 Galactose metabolism
    VIBHAR_03326
Enzymes [BR:vha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VIBHAR_03326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABU72274
UniProt: A7MV00
Position
I:complement(3359468..3360526)
Genome map
AA seq 352 aa AA seqDB search
MTEPLTITMTQQAAFDGAPANVVELKNNTGMSVTFMDIGATWLSCRLPLANGELREVLLG
VGTMGSFMQQQCYMGVTVGRYANRIANGLFEVNGEVFQVSTNQAGNCLHGGEEGFDKRRW
KIESHSNQQVTFSLLSEDGDQGFPGNLEVQVTYTLTDDNQVSIEYFAKTDKATPINLTNH
AYFNLLGAEADLDCRSHRLTIVASQYLPTSEVGIPLGELQDVKGTGFDFRSEKPVSEHFL
QDEQQIAAKGYDHSYLFDAHRDVLKPVALVVSPDEKVHLSVVTNKPAMQLYTGNWLAGAP
NRRGGEYNDYAGLALETQFLPDSPNHAEWAQPSCILEPEQEYRFCTTYQFAF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgactgagccattaactatcacgatgacacagcaggccgcctttgatggtgcgcctgcc
aacgtggtcgaactgaaaaataacacaggcatgagcgttacctttatggatattggcgcg
acatggctgagttgtcgtttacctttggcgaatggggagttgcgtgaagtgcttctcgga
gtggggacgatggggagtttcatgcagcaacagtgttacatgggtgtcactgttggtcgc
tacgcaaaccgcatcgccaatggtctttttgaagtgaatggcgaagtatttcaagtgtct
actaaccaagcgggcaactgtctgcatggtggtgaagaaggttttgataaacgtcgttgg
aagattgagtctcactcaaatcagcaagtgacgttctctttattgtctgaagatggcgac
caaggttttccgggcaatctagaagtgcaagtgacgtatacgttgactgatgataaccaa
gtgagcattgagtacttcgctaagacagataaagcgacaccgataaacttgaccaaccat
gcctattttaatttgttgggggcagaagcggacttagattgtcgttcgcatcgcttaacc
atcgttgcaagtcaatacttaccaacctctgaggtcggtattccgctgggtgaattgcaa
gatgtgaaaggcactggatttgactttagaagtgaaaaaccagtttcagaacacttctta
caagatgaacagcagattgccgccaaagggtatgaccatagctacttatttgatgctcat
cgtgatgttttaaaaccagttgcgctggtggtttcgccagatgaaaaagtgcacctttca
gtggtaacaaacaagcctgcgatgcaattgtacacgggcaactggttagctggcgcacca
aatcgccgtggcggtgaatataacgattacgcgggtctggcgttagagacgcagttttta
ccagattcgccaaaccatgctgagtgggcgcagccaagctgtattcttgagcctgaacaa
gagtaccgcttctgcaccacttatcagtttgctttctag

DBGET integrated database retrieval system