KEGG   Vibrio campbellii: VIBHAR_03337Help
Entry
VIBHAR_03337      CDS       T00589                                 

Definition
beta-D-galactosidase, alpha subunit
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vha  Vibrio campbellii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VIBHAR_03337
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VIBHAR_03337
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VIBHAR_03337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3373154..3373891
Genome map
AA seq 245 aa AA seqDB search
MQEHFRTLQVEATDDSVSITTTSIIAPPVFDFGMRCTYRYQINAQGHLNVELSGKRYGDY
PHVIPVIGLDLGINGSFDQVSYYGRGPEENYQDSRQANLIDVYHSTVADMFENYPFPQNN
GNRQHVRWASLTNRHGTGLLVKPQQEINFSAWFYTNQNLHEAQHTIELEKSGYITLNLDH
QVMGLGSNSWGSEVLDSYRVYMDEFRYGLTLMPLQAGDCSAQAMANHDFDNAFFTQPNTQ
TANEA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagcacttccgcacgctacaagtcgaagcaacggatgactcggtttcgattacg
accaccagcatcattgcaccaccggtattcgactttggcatgcgctgtacctaccgctac
caaatcaacgcacaaggtcatttgaatgtggaactgagcggtaagcgctatggcgattac
ccgcacgtaatccccgtgattggcttggatttgggcatcaacggcagctttgaccaagtg
agttactacggtcgtggccctgaagaaaactaccaagacagtcgccaagcgaacttgatt
gatgtctaccacagcacggtagccgacatgtttgagaactacccgttcccacaaaacaac
ggcaaccgacaacacgtccgctgggcgtcactgacgaatcgccacggcacggggttgttg
gtgaaaccacagcaagaaatcaacttcagcgcttggttctacaccaaccaaaacctgcac
gaagcgcaacacaccattgagctagaaaagagcggctacatcacgctcaaccttgaccat
caagtgatgggactgggctcaaactcatggggcagcgaagtgcttgattcataccgcgtg
tacatggacgagttccgctatggcctaacactgatgccacttcaagcgggcgattgcagt
gcacaagccatggcaaaccatgatttcgacaatgcgttcttcactcaaccaaatactcaa
acagcaaacgaggcgtaa

DBGET integrated database retrieval system