KEGG   Vibrio campbellii: VIBHAR_03376Help
Entry
VIBHAR_03376      CDS       T00589                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vha  Vibrio campbellii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VIBHAR_03376 (deoA)
Enzymes [BR:vha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VIBHAR_03376 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3412223..3413581)
Genome map
AA seq 452 aa AA seqDB search
MAHNELGEALMYLPQEIIRKKRDGEVLTADEINFFIQGVANNSVSEGQIAAFAMTIFFNE
MTMPERIALTCAMRDSGMVIDWNHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVP
MISGRGLGHTGGTLDKLESIPGYNITPTNDVFGQVTKDAGVAIIGQTGDLAPADKRVYAT
RDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANG
AGTKTTAILTDMNQVLASSAGNAVEVREAVRFLTDEYRNPRLLEVTMASCAEMLVLGKLA
ENTEDARAKLMEALDNGKAAECFGKMVAGLGGPVDFVENYDNYLEKAEIIKPVYATETGV
VSAMDTRAIGMAVVSMGGGRRVATDEIDYAVGFDNFIRLGEVADSDKPLAVIHARTEEQW
EEAAKALRSAITVGGEYTPTPEVYRQIRAEDL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctcataatgagcttggggaggcactaatgtatttaccacaagaaattatccgtaaa
aaacgtgacggcgaagttctaacagccgacgaaatcaacttcttcattcaaggcgtagca
aacaacagtgtatctgaaggtcagatcgccgcatttgctatgacaatcttcttcaatgaa
atgacgatgccagagcgtatcgcactaacgtgtgcaatgcgtgattcaggtatggttatc
gattggaaccacatgaactttggtggtccaattgtcgataagcactctactggtggtgtg
ggtgacgtgacttctttgatgcttggcccaatggtggcagcatgtggcggtttcgtacct
atgatctctggtcgtggtcttggccacactggcggaacgttggataagcttgagtctatt
ccaggctacaacatcactccgacaaacgacgtatttggtcaagtaaccaaagatgcaggc
gtagcaatcatcggtcaaactggtgacctagcgccagcggataagcgcgtttacgcgact
cgcgatatcacagcaacagtagacaacatttctctgatcacggcgtcgattttatcgaag
aagcttgctgcaggtcttgaatctttagtgatggacgtgaaagtaggttctggagcattc
atgccaacttacgaagcgtctgaagagctagcaaaatctatcgttgcagtagcaaacggt
gctggtactaagactacggcaattcttacggacatgaaccaagtattggcgtcttcggcg
ggtaacgcagtggaagttcgcgaagcggttcgtttcttaacggatgaataccgtaaccct
cgcctacttgaagtgaccatggcttcatgtgctgaaatgttggtgcttggcaaattggct
gagaacacagaagacgcacgtgcgaaactgatggaagcgctagataacggcaaagcggct
gagtgcttcggtaagatggtagctggtctaggtggtcctgtggatttcgtagaaaactac
gataactacctagaaaaagcagaaatcattaaaccagtatacgcaacagaaactggcgtt
gtatctgcgatggatacacgtgctatcggcatggcggttgtttcaatgggcggcggtcgt
cgcgttgcgacagatgaaatcgactacgcagttggtttcgataacttcatccgtcttggt
gaagtagcagatagcgacaaacctcttgcggttatccacgctcgcactgaagagcagtgg
gaagaagcagcaaaagcacttcgcagtgcaatcactgtaggtggtgagtacacaccaact
ccagaggtttaccgccaaatccgtgcagaagatctttaa

DBGET integrated database retrieval system