KEGG   Vibrio campbellii: VIBHAR_03403Help
Entry
VIBHAR_03403      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vha  Vibrio campbellii
Pathway
vha00790  Folate biosynthesis
vha01100  Metabolic pathways
Module
vha_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VIBHAR_03403
Enzymes [BR:vha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VIBHAR_03403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561
Motif
Other DBs
NCBI-ProteinID: ABU72348
UniProt: A7MUV3
Position
I:complement(3440785..3441615)
Genome map
AA seq 276 aa AA seqDB search
MIIKANNKSLDLSRPHVMAILNVTPDSFSDGGKFNSLELALAQVEKMIAAGVSIIDIGGE
STRPGAPDVELEEELQRVIPVIQAIRDKHDVWISVDTSKAEVMRQAVAAGADLINDVRAL
QEPGALEVAAEAKLPICLMHMKGQPRTMQANPQYDDLMGDVSAFLQERIAACEAVGIDKS
QLILDPGFGFGKTIEHNYHMLAHLDKFHEFGLPILAGMSRKSMIFKLLDKPAADCSNASV
VCATIAAMKGAQIIRVHDFEETIEAMKVVEMTNKNI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattattaaagcaaacaacaaatctctcgatctttctcgccctcatgttatggcaatc
ctcaatgtcacgcctgactcattttctgatggtggtaaatttaactcacttgaattagcg
cttgctcaagttgagaaaatgatcgccgctggtgtgagcatcatcgatatcggtggtgaa
tcaacacgaccaggtgcccctgatgttgaattagaagaagaactgcaacgtgtgattcct
gttatccaagcgatacgtgataagcacgatgtttggatttctgttgataccagtaaagct
gaagtgatgcgtcaagcggttgctgctggtgcagaccttattaacgatgttcgtgcgctt
caagagccaggagcattagaggtagcagcagaagctaagttgccaatttgcctgatgcac
atgaaaggccagccacgtacgatgcaagccaatcctcaatacgatgatctgatgggggat
gtctctgcattccttcaagaacgaattgctgcttgtgaggctgtgggtatcgataagtct
caacttatccttgacccaggttttggttttggcaaaaccatagaacacaattatcatatg
ctcgctcatctcgataagttccatgaatttggcttgccaatccttgctggtatgtcgcgt
aaatccatgattttcaagctgttggataagccagcggctgactgctccaatgcgagtgtc
gtctgtgcgactatcgcggcgatgaaaggcgcgcaaattattcgagttcatgactttgaa
gaaaccattgaagcaatgaaagtggttgagatgacgaacaaaaatatctaa

DBGET integrated database retrieval system