KEGG   Vibrio campbellii: VIBHAR_03423Help
Entry
VIBHAR_03423      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K02035  
peptide/nickel transport system substrate-binding protein
Organism
vha  Vibrio campbellii
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3465624..3467306
Genome map
AA seq 560 aa AA seqDB search
MLANIKKTALATAIIATATTGFASVATAAERSELTIHPKEFTTFVRNFNPFLGATNLHTT
TDFIYEPLVVFNEMHGNTPVFRLAENFQMSDDLMSVTFDIRKGVKWSDGQAFTADDVVYS
FNLVKEKPELDQSGINSWVTGVEKVNDYKVKFRLSEANSNVPYEIAKVPVVPKHVWSKVK
DPSTFTNENPVGTGPFTEIDTFTPQLYIQCENPNYWDAANLDVDCLRVPQIANNDQFLGK
IVNGEMDWTSSFVPDIDRTYAAASPKHHYWYPPAGTQAFVVNFKNPDAAKNEALTNVDFR
RAFSMALDRHTIIDIAFYGGGTVNDFASGLGYAFEAWSDEKTHDKFKGYNSYNAEGAKKL
LAKAGFKDVNKDGFVDTPSGKSFELLIQSPNGWTDFNNTVQLAVEQLAEVGIKARARTPD
FSVYNQAMLEGTYDVAYTNYFHGADPYTYWNSAYNSALQSGDGMPRFAMHFYKNDKLDGL
LNSFYKTADKQEQLEIAHGIQQIIAQDQVTIPVMSGAYMYQYNTTRFTGWWNEENPKGRP
NIWAGIPERLLHVLDLKPVK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaatattaaaaaaacagcactagcaacagcaattattgcaacggctactaca
ggtttcgcatcagtagctacagccgctgagcgcagtgaactgactatccaccctaaagag
tttacaacttttgttcgtaactttaaccctttcttgggtgcaactaacctacacacaact
actgactttatctacgagccgctagttgttttcaacgaaatgcacggcaacacgccagta
ttccgtctagcagaaaacttccaaatgtctgacgacctaatgagcgtaactttcgatatt
cgtaaaggcgtgaaatggtctgacggtcaagcgtttaccgctgatgacgttgtttactct
ttcaacctagtaaaagagaagccagaactagaccaatctggtatcaactcttgggttact
ggcgtagagaaagttaacgattacaaagttaagttccgtctaagcgaagcaaactcaaac
gttccttacgaaattgctaaagtacctgtcgtacctaagcacgtatggagcaaagtgaaa
gatccttcaacgttcacgaacgaaaacccagtaggtactggtccatttacagagatcgac
actttcactccgcaactatacatccagtgtgaaaacccgaactactgggatgcagcgaac
ctagacgttgactgtctgcgtgttcctcaaatcgcgaacaatgaccagttcctaggtaag
attgttaacggcgaaatggactggacttcttcattcgttccagacatcgaccgcacttac
gcagcagcgagccctaaacaccactactggtacccgccagcaggtactcaagcgttcgta
gtaaactttaagaacccagatgcagcgaaaaacgaagcactaactaacgttgacttccgt
cgcgcattctctatggctcttgaccgtcacactatcattgatatcgcattctacggcggc
ggtacagtgaacgacttcgcatctggtcttggctacgcattcgaagcttggtctgacgag
aagactcacgacaagttcaagggttacaactcttacaacgctgaaggcgctaagaagctt
ctagcgaaagctggctttaaagatgtaaacaaagacggtttcgttgacacgccatccggt
aagtctttcgagctactaatccaatctccaaacggttggactgacttcaacaacactgta
cagcttgctgttgagcaacttgcagaagtaggcatcaaagcacgtgctcgtacaccagac
ttctctgtgtacaaccaagcaatgcttgaaggtacttacgacgttgcgtacaccaactac
ttccacggtgcagacccatacacttactggaacagtgcttacaactcagcactacaatct
ggtgacggtatgcctcgcttcgcgatgcacttctacaagaacgacaagctagatggtctt
ctaaacagcttctacaagacagctgacaagcaagagcagctagaaatcgctcacggtatt
cagcaaatcatcgctcaagaccaagtgactatccctgtgatgtctggtgcttacatgtac
caatacaacacaactcgcttcactggttggtggaacgaagaaaatcctaagggccgtcca
aacatttgggctggtatcccagagcgtctacttcacgtactggacctaaaaccagttaaa
taa

DBGET integrated database retrieval system