KEGG   Vibrio harveyi: VIBHAR_03449Help
Entry
VIBHAR_03449      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vha  Vibrio harveyi
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3501987..3502472
Genome map
AA seq 161 aa AA seqDB search
MFTAYIAVGSNLADPVSQAKQAIEALKTLPNSEFVQASSLYSSTPMGPQNQPDYINAVVA
IKTNLTPLELLDCTQAIEQEQGRVRKEERWGPRTLDLDMILYGNEVIDSERLTVPHYGMR
EREFVLYPLAEIAPSLQLPDGTEVSSLLEQVDRNGLNIWQS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttcacagcgtacattgcggtaggcagtaacttggctgatcccgtcagccaagcgaag
caagcgatcgaggcattaaaaacgctaccaaactccgagtttgtgcaagcctcttcgctc
tacagtagcacgccgatgggaccacaaaaccaaccggattacatcaatgcggtggtggcg
attaaaaccaatttgacgcctcttgaactgctcgattgcacccaagcgattgagcaggaa
caagggcgtgtccgtaaagaagaacgctggggcccaagaaccttggacctcgacatgatt
ctgtacggcaatgaggtgattgattccgaaagactgacagttccacactatggaatgaga
gagcgcgagttcgtactctaccctcttgcggaaattgcaccaagtttacaactcccagac
gggaccgaggtgtcgtcactacttgaacaagtagatcgcaacggcctcaatatttggcag
tcatag

DBGET integrated database retrieval system