KEGG   Vibrio campbellii: VIBHAR_03647Help
Entry
VIBHAR_03647      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vha  Vibrio campbellii
Pathway
vha00240  Pyrimidine metabolism
vha00250  Alanine, aspartate and glutamate metabolism
vha01100  Metabolic pathways
Module
vha_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VIBHAR_03647
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VIBHAR_03647
Enzymes [BR:vha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VIBHAR_03647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace BRCT
Motif
Other DBs
NCBI-ProteinID: ABU72561
UniProt: A7MSE0
Position
I:3679174..3680139
Genome map
AA seq 321 aa AA seqDB search
MGIVTTVIGKKIMANSLYQKHIISIPELSREELELIVETAGQLKKEPRPELIKNKVVASC
FFEPSTRTRLSFETAIQRIGGDVIGFDNGGNTSLAKKGETLSDSVQVISSYVDAFVMRHP
QEGAARLASEFSNGVPVINAGDGANQHPTQTLLDLYTIAETQSRLDNLNVAFVGDLKYGR
TVHSLTQALAKFNNIRFFFVAPEALAMPDYLCEELDEAGIQYSLHTDMESVIPELDILYM
TRVQKERFDESEYAHIKSAYILTAALLEGARENLKVLHPLPRVDEITTDVDVTPHAYYFQ
QAENGVYARQALLALVLNETL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttggggatagtcaccactgttatagggaagaagatcatggcgaactcgctttaccagaag
cacatcatctctattccagagctttcacgtgaagaactggaactgattgtagaaactgca
ggtcagctaaaaaaagaacctcgtccagaactgattaaaaacaaggttgtagcgagctgt
ttctttgagccatccacgcgtactcgtctgtcgttcgagacagcaattcaacgtatcggt
ggtgatgttattggttttgataacggtggtaacacctctctggcgaaaaaaggcgagacg
ctatctgactcagttcaagttatctcttcttacgtcgatgcattcgtgatgcgccaccct
caagaaggcgcagcacgcttggcgtctgagttttctaacggcgtacccgttatcaacgca
ggtgatggcgcaaaccaacacccaacgcaaacgctactcgacctgtacaccatcgcagaa
acacaaagtcgtttagataacctgaacgttgcgtttgttggtgacctaaaatacggtcgt
accgtgcactcattgacgcaagcattggcgaagttcaacaacatccgcttcttctttgtt
gcaccagaagcacttgcgatgcctgactacctatgtgaagaacttgatgaagcaggtatc
caatacagcctgcacacagacatggaaagcgtgattcctgagctagacattctgtacatg
actcgcgtacagaaagagcgcttcgatgaatcagaatacgcacacatcaagtcagcttac
atcctaacagcggcactactagaaggtgcgcgtgagaacttgaaagtacttcacccactg
ccacgtgtggatgaaatcaccacagacgtcgacgtaacaccacacgcttactacttccaa
caagcagaaaacggcgtttacgcgcgccaagcgttgttggcactggttcttaacgaaaca
ctgtaa

DBGET integrated database retrieval system