KEGG   Vibrio campbellii: VIBHAR_03707Help
Entry
VIBHAR_03707      CDS       T00589                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vha  Vibrio campbellii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VIBHAR_03707
   00052 Galactose metabolism
    VIBHAR_03707
   00500 Starch and sucrose metabolism
    VIBHAR_03707
   00520 Amino sugar and nucleotide sugar metabolism
    VIBHAR_03707
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VIBHAR_03707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3743968..3744861
Genome map
AA seq 297 aa AA seqDB search
MRKDIPPMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCI
VTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIDSANFTYIRQREMKGLGHAIL
TGRELVGDEPFAVVLADDLCVNEQEGVLAQMVALFKQFRCSIVAVQEVPEEETHKYGVIS
GEMIKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDAL
LKQAKAGCVLAYKFKGQRFDCGSVEGYIEATNYCFENLYLKDEKKSELGKHATKKEA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggatattcccccaatgattaaaaaatgtctgttccctgcagcgggctacggt
acgcgcttcctccctgcgaccaagtctatgcctaaagaaatgatgcctgtagtgaacaag
ccactgattgaatacggtgttgaagaagcgatccaagcaggcatgaacggcatgtgcatc
gtgactggccgtggtaaacactcaatcatggaccacttcgataaaaactacgaattggaa
caccaaatcagcggtacaaacaaagaagaactgttggttgatatccgtgaaatcattgac
tctgcaaactttacctacattcgccagcgtgagatgaaaggtctaggccatgcgatccta
actggtcgtgagcttgtaggtgatgaaccatttgctgtggtactagctgatgacctttgt
gtgaacgaacaagaaggcgtactggctcaaatggtagcgctattcaaacagttccgttgc
tcaatcgttgcagttcaagaagtaccagaagaagaaactcacaaatacggcgttatctct
ggagagatgatcaaagatgacatctaccgcgtagatgacatggttgagaagccagagaaa
ggtaccgcgccaagcaacctagcaatcattggtcgctacatcctgactccagatattttc
gagctgatcgaaaacacggaaccaggtaaaggtggcgaaatacaaatcactgacgcacta
cttaagcaagcaaaagcaggctgtgtgttggcatacaaattcaaaggccaacgtttcgac
tgtggtagcgtagaaggctacatcgaagcaacaaactactgcttcgaaaacctataccta
aaagatgaaaagaagtctgagctaggcaaacacgctacgaagaaagaagcgtaa

DBGET integrated database retrieval system