KEGG   Vibrio campbellii: VIBHAR_03707Help
Entry
VIBHAR_03707      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vha  Vibrio campbellii
Pathway
vha00040  Pentose and glucuronate interconversions
vha00052  Galactose metabolism
vha00500  Starch and sucrose metabolism
vha00520  Amino sugar and nucleotide sugar metabolism
vha01100  Metabolic pathways
vha01130  Biosynthesis of antibiotics
Module
vha_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VIBHAR_03707
   00052 Galactose metabolism
    VIBHAR_03707
   00500 Starch and sucrose metabolism
    VIBHAR_03707
   00520 Amino sugar and nucleotide sugar metabolism
    VIBHAR_03707
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VIBHAR_03707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABU72621
UniProt: A7N148
Position
I:3743968..3744861
Genome map
AA seq 297 aa AA seqDB search
MRKDIPPMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCI
VTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIDSANFTYIRQREMKGLGHAIL
TGRELVGDEPFAVVLADDLCVNEQEGVLAQMVALFKQFRCSIVAVQEVPEEETHKYGVIS
GEMIKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDAL
LKQAKAGCVLAYKFKGQRFDCGSVEGYIEATNYCFENLYLKDEKKSELGKHATKKEA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggatattcccccaatgattaaaaaatgtctgttccctgcagcgggctacggt
acgcgcttcctccctgcgaccaagtctatgcctaaagaaatgatgcctgtagtgaacaag
ccactgattgaatacggtgttgaagaagcgatccaagcaggcatgaacggcatgtgcatc
gtgactggccgtggtaaacactcaatcatggaccacttcgataaaaactacgaattggaa
caccaaatcagcggtacaaacaaagaagaactgttggttgatatccgtgaaatcattgac
tctgcaaactttacctacattcgccagcgtgagatgaaaggtctaggccatgcgatccta
actggtcgtgagcttgtaggtgatgaaccatttgctgtggtactagctgatgacctttgt
gtgaacgaacaagaaggcgtactggctcaaatggtagcgctattcaaacagttccgttgc
tcaatcgttgcagttcaagaagtaccagaagaagaaactcacaaatacggcgttatctct
ggagagatgatcaaagatgacatctaccgcgtagatgacatggttgagaagccagagaaa
ggtaccgcgccaagcaacctagcaatcattggtcgctacatcctgactccagatattttc
gagctgatcgaaaacacggaaccaggtaaaggtggcgaaatacaaatcactgacgcacta
cttaagcaagcaaaagcaggctgtgtgttggcatacaaattcaaaggccaacgtttcgac
tgtggtagcgtagaaggctacatcgaagcaacaaactactgcttcgaaaacctataccta
aaagatgaaaagaagtctgagctaggcaaacacgctacgaagaaagaagcgtaa

DBGET integrated database retrieval system