KEGG   Vibrio harveyi: VIBHAR_04850Help
Entry
VIBHAR_04850      CDS       T00589                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vha  Vibrio harveyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vha00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:117545..119725
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVADMARLADSYVSAWGDEAKVSEETLRRLLTSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQEDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARESHWVNYTEVSELKMSILPLLFSEFK
ARHLDKNTDRARAFLEFVELGGESLLHQAAFDALHGELHAEDSSVWGWPVFPEKFRTFDA
AATQKYIKDNSDRVHLYMYLQWLADDQIKEAQALAEEKGMTVGLYRDLAVGVADSGSETW
ADDGALVLDASIGAPPDILGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKDDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEQQLEGLFDDRLKCKQGILDSVRWHGYLPEGIGHDAQYVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAKASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcactaaagaaagtcgcagacatggcgcgattagctgatagctac
gtcagcgcgtggggagacgaggcaaaagtttctgaagaaacactgcgccgcttgctcact
tcacttggctacgatactagcagcgatgagaagctattggcttctgctgagaaaaaacat
aagaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgcgagagcgaatttagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtcgcaaattgttcgtgatgaacgagctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttaccacaaactgatcatc
agtcgtaaacgtcgtaagactccttacgaaatgtcgctgatcatcacaccgaaagcgtgt
ttcaaacaagaagatttaaaccaacacaaaaagctatggggtccaagcattcagctttac
acactgcgtactcagcacaactggggtatcggtgactttggcgaccttaagcagttggta
agcgacatcgcatcgcgtggcggtgacttcattggtttgaacccaattcattcattgttc
cctgcgaacccagaaggtgcgagcccatacagcccgtcttctcgtcgttggttgaacatc
atgtacattgacgtaagctctgtgcctgagttcgcactaagtgcagaagcacaacaacgt
gttggcagcgctgaattccagcaacgtctacaaaaagcacgtgaatcacactgggtgaac
tacaccgaagtgtctgagcttaagatgagcattcttccgctgctatttagcgagtttaaa
gcgcgtcacctagacaagaacacagaccgtgctcgtgcattccttgagtttgtagaactt
ggtggcgagagcctgcttcaccaagcggcattcgatgcgctacacggtgaactgcacgct
gaagattcaagcgtttggggttggccagtattccctgagaagttccgcacgttcgatgca
gcggcaactcagaagtacattaaagataactcggaccgcgttcacctgtacatgtaccta
cagtggcttgcagacgaccaaatcaaagaagcgcaggctcttgctgaagaaaaaggcatg
acggttggtttgtaccgcgaccttgcggttggtgttgcggattccggtagcgagacttgg
gcggatgacggcgcgttagtattggatgcgagcatcggtgcgccaccagatatccttggt
ccactaggccaaaactggggtctaccaccgctaaacccacaagtgttggaagcaactggc
tacgacgcatacatcaagttgctgcgtgccaacatgaaacactgtggtgcactgcgtatt
gaccacgttcttggtctgcttcgtttatggtggattccaaaaggcgagaaagcgacagaa
ggtgcttacctgtattacccagttgaagacatgctggcaatcctagcacttgagtctcac
cgtcatcagtgttctgtaatcggtgaagatttgggtactgtgccagatgaaatcgtggat
atcctacgtgacgcaggcgttcactcatacaaagtgttcttcttcgaaacatcaaaagac
gacggcggctttatttctccgaagcactatgctgagcagtctatggcggcattgtgtacg
cacgatatgccaaccctccgtggtttctggcactgcgacgacttgaagatgggtcgtgag
atcggtctatacccagacgagcaacaattagaaggtctgtttgatgaccgtctgaagtgt
aagcaaggcattctcgacagcgtacgttggcacggttacctgccagaaggtatcggccat
gatgcgcaatacgtaccaatggattcttacctaagtgaagcattgcagttgcatgtggct
gcgggtgattcagcactactgagtgttcagcttgaagactggctagagatggaccaaccg
gtcaacattcctggcacggtagatgagtatccaaactggcgtcgtaaactgtcgatgaac
cttgatgaaatcttcagccgtgaagacgttaaccgtatttctaagcgcttgactgaagtg
cgcgcgaaagcgagcaaataa

DBGET integrated database retrieval system