KEGG   Vibrio campbellii: VIBHAR_04851Help
Entry
VIBHAR_04851      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vha  Vibrio campbellii
Pathway
vha00500  Starch and sucrose metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VIBHAR_04851
Enzymes [BR:vha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VIBHAR_04851
Exosome [BR:vha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VIBHAR_04851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ABU72759
UniProt: A7N5N9
Position
II:119952..122180
Genome map
AA seq 742 aa AA seqDB search
MFKNHKENIGAREKELKTKVKKKHERAYQLLAEAAYSDPFASLGPFIDDGEGSLRVWMPG
ADKVELVISGEPRIELEREDESGFILKDKRDLHLTHYQLAVDWNGVEQLIDDPYQYHNIY
QEYEHLHTPKDMYRYMGSQFVTIERGGENISGVRFLVYAPHASAISLVGSFNQWDDRRHP
MQRLDYGIWGLFIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQYPSFASITYDHNR
YQWQDAKWQNRPVTQKRDEALSFYELHVGSWKRNADGDFLNYRELAAELVPYLVDMGYTH
VELMPVSEHPFFGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGLGVVLDWVPAHFPS
DDHGLANFDGTPLFHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEQFHIDGIR
VDAVASMLYLDYSRSHDQWIPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIAEESTAF
PGVSAPTFMGGLGFGFKWNMGWMHDSLSYIQEDPIHRKYHHNTITFPLVYAHSENYVLSL
SHDEVVYGKGSIHNKMPGDEWQQTANLRAYYGYMYGQPGKKLNFMGAELGQTAEWNHDDQ
LQWFLLEFGRHQGVQALIRDLNHLYRDEAAMHDQDCVPAGFEWRLQDEAEASILAHERIS
QDGERVLVISNFTPVPHERFRLGVPMEGKYELLLNTDDAKYDGSGFDVLNSAETQEVESE
SLPQSLELRLPPLSTVFYKLAK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaccataaggagaatatcggtgctagggagaaagaattgaaaaccaaggta
aagaaaaaacacgaacgcgcttaccaattattagctgaggcggcttactcagacccattt
gcgtcacttggtccattcattgatgacggtgaaggatcgttacgcgtttggatgccaggt
gcagacaaagttgaattggttatcagcggcgaacctcgaattgagctagagcgtgaagat
gaaagcggctttatcttaaaagacaagcgtgacttgcatctaacgcattaccaacttgca
gtcgactggaatggtgtagagcagctcatcgacgacccttaccaataccacaacatttat
caagaatacgaacatctacatacaccaaaagacatgtaccgctacatgggttcacagttt
gtgaccatcgagcgcggtggtgaaaacatctctggtgttcgtttccttgtttatgcgcct
cacgcatctgctatcagcctagtgggtagctttaaccagtgggatgaccgtcgtcatcca
atgcaacgcttagattacggtatttggggcctattcattcctggtttggaagagggcgta
caatacaaatttgaacttaaaggtccaaatggggaaggacttcctcataaacaagaccct
tggggcttctactctgaacaatacccgtcattcgcatcgatcacatacgatcacaaccgt
taccagtggcaagatgcgaaatggcaaaaccgtccagtgacgcagaaacgtgatgaagcg
ttgtctttctacgaactgcacgtgggttcttggaaacgcaacgcagacggcgatttccta
aactaccgtgaactggccgctgagttagtaccttaccttgtcgacatgggctacacccac
gttgaactgatgccagtttctgaacatccgttctttggctcttggggttaccaacctgta
gggttgtttgcgccgacgagtcgctacggctctccagatgatttcaagttcttcgttgat
gcatgtcaccaagctggtttgggagtggtattggattgggtacctgcgcacttcccatcg
gatgatcatggcttagcgaattttgatggtacgcctctgttccacgatccagatcctcgc
cgtggttggcaccaagactggaactcttacatctacgatctaggtcgtgagcatgtgcgc
cgtttccttgtgtctaacgcgctttactggtttgagcaattccatattgatggtatccgt
gtggatgctgtcgcgtcgatgctctacctagactactcacgcagtcacgatcagtggatt
ccaaatgtggacggcggtaacgagaactacgatgcgatcgcaacgctgaagtggatgaac
gaagaagtgtacaagcacttcccgaatgcaatgaccattgcagaagaatcgacggcattc
ccgggcgtatctgcaccgacatttatgggcggtttaggctttggctttaagtggaatatg
ggttggatgcacgacagtctttcttacatccaagaagatcctattcatcgcaaataccac
cataataccatcacgttcccgcttgtttacgcacacagcgagaactatgtactgtcgtta
tctcatgatgaagtggtgtacggcaaaggctctatccataacaagatgccgggtgatgag
tggcaacaaacggcaaacttacgtgcctactacggttacatgtatggtcaaccgggtaag
aagctaaacttcatgggcgctgagcttggtcagaccgcagaatggaaccacgacgatcag
ttgcaatggttcttactagaatttggtcgtcaccaaggtgtgcaagcgctgattcgagac
ttgaaccatttgtaccgtgatgaagcggcgatgcacgatcaagattgtgtgccagctggt
tttgaatggcgtttgcaagatgaagcggaagcaagcattcttgcccacgagcgtattagc
caagatggcgaacgtgtattggtgatcagtaacttcacaccagtgcctcatgagcgtttc
cgtttgggcgtgccgatggaaggtaagtacgaacttctgcttaacacggacgatgcgaaa
tacgacggcagcggctttgatgtgctaaacagcgcagaaacgcaagaagtagaaagtgaa
tcgctacctcagtctcttgagctgcgtctaccgccactatcaaccgtattctacaaactg
gcaaagtaa

DBGET integrated database retrieval system