KEGG   Vibrio campbellii: VIBHAR_05553Help
Entry
VIBHAR_05553      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vha  Vibrio campbellii
Pathway
vha00010  Glycolysis / Gluconeogenesis
vha00020  Citrate cycle (TCA cycle)
vha00620  Pyruvate metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
vha01200  Carbon metabolism
Module
vha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_05553
   00020 Citrate cycle (TCA cycle)
    VIBHAR_05553
   00620 Pyruvate metabolism
    VIBHAR_05553
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VIBHAR_05553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 Glyco_hyd_65N_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABU73457
UniProt: A7N8D1
Position
II:complement(757309..758451)
Genome map
AA seq 380 aa AA seqDB search
MKTFNLPDLGEGLAESEIVKWHISVGDMVQLDQIVLTVETAKATVDVPAPYGGRIVSRHG
EEGDVINIGALLLEIDETGAEQAATEQKQTADAATVVGNVSQHAHSVNVDDFWIGGEHNP
SPDNLISALPSARLLANKLGVDLASVKGSGPDGLILDSDIYDEAGKQRPGTEVLKGARRT
MVSTMAESHHNVAAVTITEEAVLDGWKQGEDISIRLVQAIVHACQEEPAMNAWFDAETMT
RCVHSTVNIGIAVDSRHGLYVPVLRHADEYEPQEVRRWLDQTVQGIRERKIGRDQLQHAT
ITLSNFGAIAGIYATPVVTPPQVAIVGAGRIIEKVVIRDGQAVAVKAMPLSITFDHRACT
GGEAARFTKVLAEHLRKPSV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtttaacttacccgatctcggcgaaggtctcgctgagtcagaaattgtgaaa
tggcatattagtgttggcgatatggtccaactcgatcaaatagtacttaccgtggaaacc
gcaaaagcgacagtggatgtccctgctccttatggtggtcgcatcgtcagtcgtcacggt
gaagaaggtgatgtgattaacatcggtgctctacttctggaaatcgatgaaactggggca
gaacaagcagctacagaacaaaagcaaacggctgatgctgcaaccgtggtgggtaatgtc
tcccagcacgcacatagcgtgaatgtcgatgacttctggattggcggtgaacataacccc
tctcccgataatctcatcagcgctctcccttcggcgcgtttgttagcgaataaactagga
gtcgatttagcgtcggtgaaaggtagcggccccgacggtttaatccttgattcagatatc
tatgacgaagctggcaaacagcgcccaggaacagaggtgctgaaaggtgcacgtcgaacc
atggtgtcgacaatggcggaatctcaccataatgtcgcagcagtaaccattactgaggaa
gcggtcttagatggttggaagcaaggcgaagacatcagtattcgtctcgtccaagccatt
gtgcatgcttgtcaggaagaacccgccatgaatgcatggtttgatgcggaaaccatgacg
cgttgtgtccacagtacagtcaacatcggtattgcggtcgacagccgacacggtttgtac
gtgcctgttcttcgacacgctgatgagtatgagccgcaagaggtgcgccgttggttagat
caaaccgtacaaggtatacgcgaacgtaagattggtcgcgatcagttacagcacgccacc
attacgctttcaaattttggcgcaattgcaggtatctacgcaacgcctgttgtaactcct
ccgcaagttgcgattgtcggtgcgggtcgaatcattgagaaggtcgtaattcgagacggg
caagctgtagcagtgaaagccatgccgctgtcgattacgtttgaccaccgagcatgtact
ggtggtgaagcagcaaggttcacaaaagtactggcagagcacttgagaaaaccgagtgtt
tag

DBGET integrated database retrieval system