KEGG   Vibrio campbellii: VIBHAR_05801Help
Entry
VIBHAR_05801      CDS       T00589                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vha  Vibrio campbellii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VIBHAR_05801
Enzymes [BR:vha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VIBHAR_05801
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VIBHAR_05801
Lipid biosynthesis proteins [BR:vha01004]
 Fatty acid synthase
  Component type
   VIBHAR_05801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:990011..990613
Genome map
AA seq 200 aa AA seqDB search
MIRILSLVLFFCLSATAHASEKLLVLGDSLSAGYQMPIEESWPSLLPGALLEHGQDVKVV
NGSISGDTTGNGLARLPSLLEQHTPDLVLIELGANDGLRGFPPKLITLNLSKMITMIKDS
GADVVMMQIRVPPNYGKRYSDMFYDIYPKLAEHQQVALMPFFLEHVIIKPEWMMDDGLHP
KPEAQPYIADFVAQELVKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtatactttccttagttctctttttctgcctttccgctacagcacatgcgagc
gaaaagctacttgttttgggcgacagcctgagcgctggttatcaaatgcctatagaggag
agttggcctagcttactcccaggcgcgttattagaacatggccaagatgtaaaagttgta
aacggtagcatctctggtgacaccacaggcaatggccttgcacggttaccttctctcctt
gagcaacacacgcccgatttggtactgattgagcttggcgctaacgatggcctacgcggt
ttcccacctaaacttattacgttaaacctatcgaaaatgattaccatgatcaaagattct
ggtgcggatgtcgtcatgatgcaaatccgcgtcccaccaaattatggtaagcgttacagc
gatatgttctacgacatctaccctaaactggcagaacatcagcaagtagcgctaatgccg
ttcttcttagagcatgtcatcattaaaccagaatggatgatggacgatggcttgcaccca
aaaccggaagctcaaccctacattgctgactttgtcgctcaagaattggttaaacatctc
taa

DBGET integrated database retrieval system