KEGG   Vibrio campbellii: VIBHAR_06094Help
Entry
VIBHAR_06094      CDS       T00589                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vha  Vibrio campbellii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VIBHAR_06094
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VIBHAR_06094
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VIBHAR_06094
Lipid biosynthesis proteins [BR:vha01004]
 Desaturase
  First
   VIBHAR_06094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1257434..1258558
Genome map
AA seq 374 aa AA seqDB search
MTHNKPPLIWLNILIFSASFILTFVVLPWYAYHYGLGWEHLIWGILAFSFTNLSITAGYH
RLWSHKTYEAHPVLRFIFAIGGAFSLQNSAMHWSSDHRVHHKHVDDNDKDPYSAKRGFWY
SHIGWMLRDYNQSRENEYTNCRDLKRDKIVAWQHKYYVPLAIVTNIGFPLLLGLIYGDIW
GMFLIVGAARLFLSHHTTFFINSLAHVWGKQTFTDKNTARDNGILAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTTKLRTTSTFRIEKARATQLLKKAKEKLESK
PNSQSIRDQLQKEFDALVHHMQEYYEVRKEVLGEKTATVVKKYERSVSKLKHQQIKEEFE
RQQRSWNLLVRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcataataaaccgcctcttatctggctgaatatattgatattttctgccagcttt
atactgaccttcgttgtattgccttggtatgcataccattacggattaggttgggaacat
ttgatctggggcattctcgcctttagctttaccaatctctccattaccgcgggttatcac
cgcttatggagccacaaaacctacgaagctcacccagttttacgattcatctttgccatc
ggtggtgccttctctcttcaaaacagtgcgatgcattggtcctctgatcatcgagttcat
cacaaacatgtcgacgataacgacaaagacccgtattcagcgaaacgcggtttttggtac
tcgcatattggttggatgcttcgtgattacaaccaatcaagagagaacgagtacacgaac
tgtcgcgatttgaagcgagacaaaatcgttgcatggcagcacaagtattacgttccttta
gctattgtgactaatatcggctttcctcttttactgggtcttatctatggtgatatctgg
ggaatgttcctgatcgttggtgctgctcgcctgtttttgagccatcacacgactttcttt
atcaattcattggcacatgtttggggtaaacaaaccttcaccgataaaaacactgctcgt
gacaatggcattttggcattctttacctttggtgagggctaccacaacttccatcacatc
tttgagaacgattaccgtaatggcgtttactggtggcactacgatccaaccaaatggctg
atcaagtcctgttcttggttgggcttaacaacgaagcttcgtacgacgtcaacgtttcgc
atagaaaaagcacgcgcgacgcagttattgaagaaagccaaagaaaaactagagagtaag
ccaaacagccagtcgattcgtgatcagcttcagaaggagttcgacgcattagtgcatcat
atgcaggaatactacgaagtgcgcaaagaagtgctcggagagaaaacagcgacagtagtg
aaaaaatacgagcgctcggtatcaaagttgaagcaccaacaaattaaagaagaatttgag
cgtcaacaacgcagttggaaccttttagtacgtcgctacgcctaa

DBGET integrated database retrieval system